Candidatus Tenderia electrophaga: Tel_03730 Help Entry Tel_03730         CDS       T04171                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism tee  Candidatus Tenderia electrophaga Brite KEGG Orthology (KO) [BR:tee00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tee03036]     Tel_03730 Chromosome and associated proteins [BR:tee03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Tel_03730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  ALP54726 UniProt:  A0A0S2THS4 LinkDB All DBs Position 806288..806530 Genome browser AA seq 80 aa AA seqDB search MLGAVVLMSAVAVVYAKYESRTLFAELQSLKQAQDRMDVEWGQLQLEQSTWAAHGRIESI ARKRLGMVLPEPQQVVVIKP NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgctcggcgcggtggtgctgatgtcggccgtggcggtggtctacgccaaatacgagagc cgcaccttgtttgccgagctgcaaagtttgaagcaggcacaggaccgtatggatgtggag tgggggcaattgcagttggagcaaagtacctgggcggcccacggccgtattgaatcgatt gcgcgcaagcgcttgggcatggtcttgcccgagccgcaacaggtggtggtgatcaaacct tga

DBGET integrated database retrieval system