KEGG   Candidatus Tenderia electrophaga: Tel_03780Help
Entry
Tel_03780         CDS       T04171                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tee  Candidatus Tenderia electrophaga
Pathway
tee00473  D-Alanine metabolism
tee00550  Peptidoglycan biosynthesis
tee01100  Metabolic pathways
tee01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tee00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Tel_03780
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tel_03780
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Tel_03780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tee01011]
    Tel_03780
Enzymes [BR:tee01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Tel_03780
Peptidoglycan biosynthesis and degradation proteins [BR:tee01011]
 Precursor biosynthesis
  Amino acid ligase
   Tel_03780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp ATPgrasp_Ter ATP-grasp_4 RimK TTL
Motif
Other DBs
NCBI-ProteinID: ALP52333
UniProt: A0A0S2TB38
LinkDB All DBs
Position
818199..819149
Genome map
AA seq 316 aa AA seqDB search
MSLAPSHITDPKHFGKVAVLMGGRSAEREISLKSGAAVLRALQEKGVDAHELDVSDNVLM
DLRAGDYDRAFIILHGRGGEDGVMQGALETIGMPYTGSGVLGSALGMDKLRCKQLWQGAG
MSTPPYAVVNEASDFARIVEALGLPLIVKPSREGSSIGMTKVADPAQLAHAVRQAAALDD
SVIVEAWISGPEYTVAVLNGVALPAIRLETPRDFYDFEAKYQADDTRYHCPCGLDELHER
ELQRLAVEAFGLVGASGWGRVDFMSDAAGRCYLLEVNTVPGMTDHSLVPMAARAAGMRFA
DLVWRILETSFREGKR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtttggcgccatcgcacatcactgatcccaagcatttcggcaaggtggcggtgctc
atgggcggccgttccgccgaacgcgagatctcgctcaagagcggtgccgccgtgctgcgc
gctttgcaggagaaaggggtggacgcccatgagttggatgtctcggacaatgtgctgatg
gacctgcgcgccggcgactatgatcgcgccttcattatcctgcacggccgtggcggcgaa
gacggtgtcatgcagggggcgctggagactatcggtatgccctataccggcagtggtgtg
ctgggctcggccctgggtatggacaagctgcgctgcaaacagctgtggcagggggcgggc
atgagtacgccgccctatgcagtggtgaacgaggccagcgatttcgcgcgcatcgtcgaa
gcgctgggtctgccgctgattgtcaaaccgtcccgtgaggggtccagtatcggcatgacc
aaggtcgctgatccggcgcaactggcgcatgcggtgcgccaggcggcggcgctggatgac
agcgttatcgtcgaggcctggatcagcggacccgagtataccgtggccgttctgaacggt
gtggcgctgcccgccatccgcctggagacgccgcgcgatttttatgacttcgaggccaag
tatcaggccgacgacacccgctatcactgcccctgcggtctggatgaattgcacgagcgc
gaattgcagcgcctcgctgtcgaggcgttcggcttggtcggtgccagtggctggggacgg
gtggatttcatgagcgacgccgccgggcgatgttacctgctggaggtgaataccgtgccc
ggcatgacggatcacagcctggtgcccatggcggcgcgggcggccggtatgcgtttcgcg
gatttggtatggcggattttggaaacctcgtttcgggagggcaaacgatga

DBGET integrated database retrieval system