KEGG   Candidatus Tenderia electrophaga: Tel_12770Help
Entry
Tel_12770         CDS       T04171                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
tee  Candidatus Tenderia electrophaga
Brite
KEGG Orthology (KO) [BR:tee00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Tel_12770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tee03400]
    Tel_12770
Enzymes [BR:tee01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Tel_12770
DNA repair and recombination proteins [BR:tee03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Tel_12770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ALP53937
UniProt: A0A0S2TFK7
LinkDB All DBs
Position
2791144..2792151
Genome map
AA seq 335 aa AA seqDB search
MTDWRDQLSAAQRQALTRKTMPKWTEPMLATLTDARFSADDWIFERKLDGERCLVFRRKS
RLHILSRNRQDLNDTYPELVRALSQEGPEHYIVDGEIVAFEGRRTSFSRLQGRIGIDDPD
AARASGIKVYLYLFDLLYLDNADLTGLPLRRRKQLLRRCFDFKDPLRFTAHRNECGEAYY
QEACDKGWEGLIAKRADSPYVHSRSKHWLKFKCVKRQELVIAGYTDPQGSRIGFGALLLG
YYHHKQLRYAGKVGTGFDDKTLKQLGETLKSMQQDDCPYAETPNQAGKDVHWVKPTLVAE
IGFTEWTADQRLRHPRFVGLRHDKAATQVVRETPE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgactggcgcgaccaattgagcgcggcgcaacgccaggccctaacacgaaagacc
atgcccaaatggaccgagcccatgttggccaccctcaccgatgcgcgtttctccgctgac
gattggatcttcgaacgcaagctggacggcgaacgctgcctggtgttccgacgcaaaagc
cgcttgcatatcctgtcgcgcaaccggcaggacctcaacgacacctatcccgaactggtc
cgcgcgctgtcccaggaaggacccgagcactacatcgtcgacggcgagatcgtcgccttc
gagggtaggcgcactagtttctcccgcttgcagggacgcatcggcatcgacgaccccgac
gcggcgcgcgccagcggcatcaaggtctatctctatctctttgacctgctctatctggac
aacgccgatctgacgggcttgcccctgcgcaggcgcaagcagctgttgcggcgttgtttc
gacttcaaggacccgttacggtttaccgcccaccgcaacgaatgcggcgaagcctactat
caggaggcctgcgacaagggctgggagggcttgatcgccaagcgcgccgacagcccctat
gtccacagccgctccaagcactggctgaagttcaagtgcgtcaagcgccaggagctggtg
atcgccggctataccgacccccaaggcagtcgcatcggcttcggcgccctgttgctgggc
tactatcaccacaagcaactgcgctatgccggcaaggtgggcaccggcttcgatgacaaa
accctgaaacagttgggcgagacgcttaaatctatgcaacaggatgactgcccctatgcc
gagacccccaaccaggccggcaaggacgtacactgggtcaaacccacgctggtggccgag
atcggcttcaccgaatggaccgcggatcagcgcctgcgccatccgcgctttgtgggattg
cgtcacgacaaggccgccacccaggtggtgcgcgagacgccggagtaa

DBGET integrated database retrieval system