KEGG   Taylorella equigenitalis 14/56: KUK_1286Help
Entry
KUK_1286          CDS       T02604                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
teg  Taylorella equigenitalis 14/56
Pathway
teg00473  D-Alanine metabolism
teg01100  Metabolic pathways
teg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:teg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    KUK_1286
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    KUK_1286
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:teg01011]
    KUK_1286
Enzymes [BR:teg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     KUK_1286
Peptidoglycan biosynthesis and degradation proteins [BR:teg01011]
 Precursor biosynthesis
  Racemase
   KUK_1286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CCG18582
UniProt: I7JQD7
LinkDB All DBs
Position
complement(1384765..1386003)
Genome map
AA seq 412 aa AA seqDB search
MKYPLKSLTIVIASLFAAQSNSAPVLSTDDVKVSQLSELSANAWIEVDVQAFENNIAELQ
KLLNGKSKVCAILKADAYGHGINLLMPSIIKMNVPCIGIASNEEARIARAHNYEGTIMRV
RAASINEIKDGLKYDMEELVGDVTQAQTINALAKEAGKDVRIHISLNSAGMDRNGIDMST
DNGRAEALELTKFSNLKVVGIMTHYPEENEEIIRKDLVRFNEDSKWLIENAGLNRNQIVI
HTANSYTTLTVPEAHFDMVRPGGLLYGDSIPTRTEYKRILSFKSRVANINHYPKGSTVGY
DRTFKLERDSMLANLPFGYSDGYRRIFSNKGYVLINGHKVPVVGRVSMNTTMVDVTDFPD
ILEGAEVVIFGTQGDAKVEQADIEEINGALLADLYTVWGNSNPRIAKPTTTN
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacccacttaaatcgctaactattgttattgcttcactttttgctgctcaaagt
aactctgcacctgtacttagtacagatgatgtgaaggttagtcagttatcagagttatct
gctaatgcgtggatagaggttgatgttcaggccttcgaaaataatattgcggaactccaa
aaattgcttaatggtaagtctaaggtttgtgcaattcttaaagctgatgcttatggtcat
ggtattaatcttttgatgcctagtattataaaaatgaatgtgccatgcattggtattgcc
agcaatgaagaggcccgaatcgcaagagctcacaattatgaaggcactattatgagggtt
cgggcggcatctataaatgaaattaaggatggtcttaaatatgatatggaagagcttgta
ggggatgtgacacaagctcaaactattaatgctttggctaaggaagcggggaaagatgta
cgaattcacatttcactgaattctgctggtatggatagaaatggaattgatatgtctaca
gataatggtagggcagaagcacttgagcttactaagttttctaatttaaaagtagtgggt
attatgactcactatccagaagaaaatgaggaaattattcgtaaggatttggttcgtttt
aatgaagattccaagtggctaatcgaaaatgcagggttaaatcgcaatcaaatcgtcatt
catactgctaattcttatacaaccttgacagttccagaagcacatttcgatatggttaga
ccaggtggacttctgtatggggattctatacctacgagaactgaatacaaacgtatactc
tcatttaaatcgagagtggcaaatataaatcattatccaaaaggttcaacggtagggtat
gacagaacttttaagttagaaagagactcaatgctggcgaatttgccctttgggtattct
gatggttatagacgtattttttctaataaaggttatgttcttattaatgggcataaagtt
cctgtggtaggtagagtgtctatgaatactactatggtggatgttacagattttcctgat
attttagagggggcagaagtagtgatttttggcactcagggagatgcaaaagtagagcag
gccgatatcgaggaaatcaacggagccttacttgccgatctatatacagtgtggggaaat
tcaaatcctcgaatagcaaaacctacaacaactaattaa

DBGET integrated database retrieval system