KEGG   Thermosynechococcus elongatus: tll1299Help
Entry
tll1299           CDS       T00090                                 

Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00010  Glycolysis / Gluconeogenesis
tel00020  Citrate cycle (TCA cycle)
tel00620  Pyruvate metabolism
tel01100  Metabolic pathways
tel01110  Biosynthesis of secondary metabolites
tel01120  Microbial metabolism in diverse environments
tel01130  Biosynthesis of antibiotics
tel01200  Carbon metabolism
Module
tel_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    tll1299
   00020 Citrate cycle (TCA cycle)
    tll1299
   00620 Pyruvate metabolism
    tll1299
Enzymes [BR:tel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     tll1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl AATase MadL ATP-grasp
Motif
Other DBs
NCBI-GeneID: 1011099
NCBI-ProteinID: NP_682089
CYORF: tll1299
UniProt: Q8DJC8
LinkDB All DBs
Position
complement(1349471..1350751)
Genome map
AA seq 426 aa AA seqDB search
MIRELFMPALSSTMTEGKIVSWLKSPGDKVTKGETVLIVESDKADMDVESFYDGYLAVIT
VPAGEVAPVGSTIGLVAETEAEIAEAEAKAKSLGTATSSGPAPASTSTVATSNGSGTAPV
AAAPAASAAVPAGRVMASPRARKLAKEHKIDLKTLKGTGPNGRITAADVEALIGAPATPV
PPVATSPAPIPTAPPATAAVVAKEDLVPLTTLQNAVVRNMVASLGIPDFHVAYTITTDAL
DRLYQQIKSKGVTMTALLAKAIALTLQKHPIMNAYYTEQGIQYRRDINIAVAVAMPGGGL
ITPVLKNADQIDLYSLSRTWKDLVERARAKQLQPDEYSTGTFSLSNLGMFGVDFFDAILT
PGQGAIMAVGASRPTVVATEDGLLGVKRQMKVNITCDHRVIYGADAAAFLQDLAKLIETN
PQALTL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtgaactgttcatgcccgccctcagctccaccatgaccgaaggcaaaattgtc
tcttggctgaaatctcccggggataaggtgaccaaaggggaaacggtgctgattgtggaa
tccgacaaggccgatatggatgtggagtccttctacgacggctatttggcggtgattacc
gtacctgctggcgaagtggcacccgtcggctccaccattggccttgtggcagaaacagaa
gcagaaattgcggaggcggaggcaaaggccaagtcccttgggacggctaccagttctggg
ccagctccggcctcaacttcgactgtggccaccagtaatggctcaggaacggctcctgta
gcagcggctcctgccgccagtgctgctgtaccggctgggcgagtgatggcctccccccgt
gcccgcaagttggccaaggaacacaaaattgatttgaagaccctcaagggaactggcccc
aatggtcggattacagccgccgatgtggaagctttgattggggcacctgcaacccctgtg
ccacccgtggcaacgtcccctgcgcctatccccacggcaccccctgctactgcggcggtg
gtcgctaaggaggatttggtgcccctgacaacgctgcaaaatgcggttgtgcgcaatatg
gtggccagccttggcattcccgatttccatgttgcctacacgattacaaccgatgccttg
gatcggctgtatcagcaaattaagtccaaaggggtgaccatgacggcgctccttgccaag
gcgatcgccctgacattgcaaaaacacccaattatgaatgcctactacacagagcagggg
attcaataccgtcgtgatattaacatcgctgttgctgtggcgatgccgggggggggtctg
attacaccggtgctgaagaacgccgatcaaattgacctctacagcctctcccgtacttgg
aaagacttggtggaacgggcgcgcgctaagcaactgcaacccgatgagtacagcacaggc
acctttagcctctcgaacctcggcatgtttggagttgacttctttgatgccattctcacg
cccggccaaggggccattatggcggtgggggcatcgcggccgacggtggttgctacggag
gatggcctgctcggggtaaaacggcagatgaaagtgaatatcacctgtgatcaccgggtg
atctatggtgcggatgcagccgctttccttcaggatttggcgaaactgattgaaaccaat
cctcaagccctgacgctctaa

DBGET integrated database retrieval system