KEGG   Thermosynechococcus elongatus: tll1299
Entry
tll1299           CDS       T00090                                 

Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00010  Glycolysis / Gluconeogenesis
tel00020  Citrate cycle (TCA cycle)
tel00620  Pyruvate metabolism
tel01100  Metabolic pathways
tel01110  Biosynthesis of secondary metabolites
tel01120  Microbial metabolism in diverse environments
tel01200  Carbon metabolism
Module
tel_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    tll1299
   00020 Citrate cycle (TCA cycle)
    tll1299
   00620 Pyruvate metabolism
    tll1299
Enzymes [BR:tel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     tll1299
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl MadL AATase ATP-grasp
Other DBs
NCBI-GeneID: 1011099
NCBI-ProteinID: NP_682089
CYORF: tll1299
UniProt: Q8DJC8
LinkDB
Position
complement(1349471..1350751)
AA seq 426 aa
MIRELFMPALSSTMTEGKIVSWLKSPGDKVTKGETVLIVESDKADMDVESFYDGYLAVIT
VPAGEVAPVGSTIGLVAETEAEIAEAEAKAKSLGTATSSGPAPASTSTVATSNGSGTAPV
AAAPAASAAVPAGRVMASPRARKLAKEHKIDLKTLKGTGPNGRITAADVEALIGAPATPV
PPVATSPAPIPTAPPATAAVVAKEDLVPLTTLQNAVVRNMVASLGIPDFHVAYTITTDAL
DRLYQQIKSKGVTMTALLAKAIALTLQKHPIMNAYYTEQGIQYRRDINIAVAVAMPGGGL
ITPVLKNADQIDLYSLSRTWKDLVERARAKQLQPDEYSTGTFSLSNLGMFGVDFFDAILT
PGQGAIMAVGASRPTVVATEDGLLGVKRQMKVNITCDHRVIYGADAAAFLQDLAKLIETN
PQALTL
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgattcgtgaactgttcatgcccgccctcagctccaccatgaccgaaggcaaaattgtc
tcttggctgaaatctcccggggataaggtgaccaaaggggaaacggtgctgattgtggaa
tccgacaaggccgatatggatgtggagtccttctacgacggctatttggcggtgattacc
gtacctgctggcgaagtggcacccgtcggctccaccattggccttgtggcagaaacagaa
gcagaaattgcggaggcggaggcaaaggccaagtcccttgggacggctaccagttctggg
ccagctccggcctcaacttcgactgtggccaccagtaatggctcaggaacggctcctgta
gcagcggctcctgccgccagtgctgctgtaccggctgggcgagtgatggcctccccccgt
gcccgcaagttggccaaggaacacaaaattgatttgaagaccctcaagggaactggcccc
aatggtcggattacagccgccgatgtggaagctttgattggggcacctgcaacccctgtg
ccacccgtggcaacgtcccctgcgcctatccccacggcaccccctgctactgcggcggtg
gtcgctaaggaggatttggtgcccctgacaacgctgcaaaatgcggttgtgcgcaatatg
gtggccagccttggcattcccgatttccatgttgcctacacgattacaaccgatgccttg
gatcggctgtatcagcaaattaagtccaaaggggtgaccatgacggcgctccttgccaag
gcgatcgccctgacattgcaaaaacacccaattatgaatgcctactacacagagcagggg
attcaataccgtcgtgatattaacatcgctgttgctgtggcgatgccgggggggggtctg
attacaccggtgctgaagaacgccgatcaaattgacctctacagcctctcccgtacttgg
aaagacttggtggaacgggcgcgcgctaagcaactgcaacccgatgagtacagcacaggc
acctttagcctctcgaacctcggcatgtttggagttgacttctttgatgccattctcacg
cccggccaaggggccattatggcggtgggggcatcgcggccgacggtggttgctacggag
gatggcctgctcggggtaaaacggcagatgaaagtgaatatcacctgtgatcaccgggtg
atctatggtgcggatgcagccgctttccttcaggatttggcgaaactgattgaaaccaat
cctcaagccctgacgctctaa

DBGET integrated database retrieval system