KEGG   Thermosynechococcus elongatus: tll1504Help
Entry
tll1504           CDS       T00090                                 

Gene name
rbcS
Definition
(RefSeq) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00630  Glyoxylate and dicarboxylate metabolism
tel00710  Carbon fixation in photosynthetic organisms
tel01100  Metabolic pathways
tel01120  Microbial metabolism in diverse environments
tel01200  Carbon metabolism
Module
tel_M00165  Reductive pentose phosphate cycle (Calvin cycle)
tel_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
tel_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:tel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    tll1504 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    tll1504 (rbcS)
Enzymes [BR:tel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     tll1504 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 1011207
NCBI-ProteinID: NP_682294
CYORF: tll1504
UniProt: Q8DIS7
LinkDB All DBs
Structure
PDB: 

Position
complement(1573812..1574168)
Genome map
AA seq 118 aa AA seqDB search
MKTLPKERRYETFSYLPPLSDAQIARQIQYAIDQGYHPCVEFNETSNAEIRYWTMWKLPL
FNCTNAQDVLNEVQQCRSEYPNCFIRVVAFDNIKQCQVMSFIVYKPNQANSGYSGYRY
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactgcccaaagagcgtcgttacgaaaccttctcctacctacctcccctcagt
gatgcccaaattgctcgccaaatccagtatgcgattgatcagggctatcacccctgtgtg
gagttcaacgagacctccaatgctgaaatccgctactggacaatgtggaaactgccgctt
tttaactgcaccaacgcccaagacgtgctcaatgaagtacagcagtgccgctcggaatat
cccaattgtttcatccgtgttgttgcctttgacaacatcaaacagtgccaagtgatgagc
tttattgtctataagcccaatcaggccaacagcggctacagcggttatcgctattaa

DBGET integrated database retrieval system