KEGG   Thermosynechococcus elongatus: tll1519Help
Entry
tll1519           CDS       T00090                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tel  Thermosynechococcus elongatus
Brite
Enzymes [BR:tel01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     tll1519 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Phage_portal
Motif
Other DBs
NCBI-GeneID: 1011132
NCBI-ProteinID: NP_682309
CYORF: tll1519
UniProt: Q8DIR2
LinkDB All DBs
Structure
PDB: 

Position
complement(1586170..1586772)
Genome map
AA seq 200 aa AA seqDB search
MAFVQEPLPFDPGALEPYGMSAKTLEFHYGKHHKGYVDNLNKLTQDTELADKSLEDVIRT
TYGDAAKVGIFNNAAQVWNHTFFWNSLKPGGGGVPTGDVAARINSAFGSYDEFKAQFKNA
AATQFGSGWAWLVLEAGTLKVTKTANAENPLVHGQVPLLTIDVWEHAYYLDYQNRRPDFI
DNFLNQLVNWDFVAKNLAAA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgtacaagaaccccttccctttgatccgggtgcccttgaaccctatggcatg
tctgcgaaaacccttgaatttcactatggcaaacaccataagggctacgtggataacctc
aataagctgactcaagataccgaactcgctgacaaatcccttgaagatgtcattcgcaca
acctatggcgatgctgccaaagtgggcatcttcaacaatgccgctcaagtgtggaatcac
accttcttctggaatagcctcaagccaggtggcggtggtgtgcctacgggtgatgtggcc
gctcggatcaacagtgcttttgggagctacgacgaattcaaagcccagttcaaaaatgcc
gcggcgacccaatttggcagtggttgggcatggctggtgctcgaagctggcacactgaag
gtgactaaaactgccaatgccgaaaaccccttagttcacggtcaagtgcccctactgacg
attgatgtttgggagcacgcctactatctcgactaccaaaaccgtcgtcccgactttatt
gataacttcctgaaccaattggtgaactgggattttgttgctaagaacttggcggctgcc
taa

DBGET integrated database retrieval system