KEGG   Thermosynechococcus elongatus: tll1912Help
Entry
tll1912           CDS       T00090                                 

Gene name
ppc
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tel  Thermosynechococcus elongatus
Pathway
tel00620  Pyruvate metabolism
tel00680  Methane metabolism
tel00710  Carbon fixation in photosynthetic organisms
tel01100  Metabolic pathways
tel01120  Microbial metabolism in diverse environments
tel01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    tll1912 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    tll1912 (ppc)
   00680 Methane metabolism
    tll1912 (ppc)
Enzymes [BR:tel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     tll1912 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 1011076
NCBI-ProteinID: NP_682702
CYORF: tll1912
UniProt: P0A3X5
LinkDB All DBs
Position
complement(1999433..2002468)
Genome map
AA seq 1011 aa AA seqDB search
MTSVLDVTNRDRLIESESLAARTLQERLRLVEEVLVDVLAAESGQELVDLLRRLGALSSP
EGHVLHAPEGELLKVIESLELNEAIRAARAFNLYFQIINIVEQHYEQQYNRERAAQEGLR
RRSVMSEPISGVSGEGFPLPHTAANATDVRSGPSERLEHSLYEAIPATQQYGSFAWLFPR
LQMLNVPPRHIQKLLDQLDIKLVFTAHPTEIVRQTIRDKQRRVARLLEQLDVLEGASPHL
TDWNAQTLRAQLMEEIRLWWRTDELHQFKPEVLDEVEYTLHYFKEVIFAVIPKLYRRLEQ
SLHETFPALQPPRHRFCRFGSWVGGDRDGNPYVKPEVTWQTACYQRNLVLEEYIKSVERL
INLLSLSLHWCDVLPDLLDSLEQDQRQLPSIYEQYAVRYRQEPYRLKLAYVLKRLQNTRD
RNRALQTYCIRRNEAEELNNGQFYRHGEEFLAELLLIQRNLKETGLACRELDDLICQVEV
FGFNLAALDIRQESTCHAEALNEITAYLGILPCPYTELSEAERTRWLLSELSTRRPLIPG
ELPFSDRTNEIIETFRMVRQLQQEFGTDLCNTYIISMSHEVSDLLEVLLFAKEAGLFDPA
TGASTLQAIPLFETVEDLKHAPAVLTQLFSLPFCRSYLGSNSTPFLQEVMLGYSDSNKDS
GFLSSNWEIYKAQQQLQKIAESFGFQLRIFHGRGGSVGRGGGPAYAAILAQPAQTIKGRI
KITEQGEVLASKYSLPELALFNLETVATAVIQASLLRSSIDEIEPWHEIMEELATRSRQC
YRHLIYEQPEFIEFFNEVTPIQEISQLQISSRPTRRGGKKTLESLRAIPWVFSWTQTRFL
LPAWYGVGTALKEFLEEKPAEHLSLLRYFYYKWPFFRMVISKVEMTLAKVDLEIARYYVQ
ELSQPQNREAFCRLYDQIAQEYRLTTELVLTITGHERLLDGDPALQRSVQLRNRTIVPLG
FLQVSLLKRLRQHNSQTTSGAILRSRYGRGELLRGALLTINGIAAGMRNTG
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagtcctcgatgtgaccaatcgcgatcgcttaattgaaagtgaaagtttggca
gcccgtaccctacaggaacggttgcgactggtggaagaggtcttggtcgatgtcttggcg
gcagaatcgggtcaagaattggttgatctattgcggcgcttgggggctctctcttcgccg
gaaggtcatgtgctccatgccccagaaggggaattgctgaaggttattgaatccctcgaa
ctcaatgaggccattagagcggcccgggcttttaacctctactttcaaattatcaacatc
gttgagcagcactatgaacaacaatacaaccgtgaacgcgctgcccaagagggattgcgc
cgccgcagtgtcatgagtgaaccaatttccggtgtcagtggtgaaggctttccgctgcct
catactgctgccaacgcaacggatgtgcgcagtgggccgagtgaacgcctagagcatagt
ctctacgaagccattcccgctactcagcagtatggttcctttgcttggctctttcctcgg
ctgcagatgttgaatgtgccgccgcgccatattcaaaagcttttggatcaactggacatt
aagttggtgttcactgcccacccgacggagattgtgcggcaaacgattcgtgataagcag
cggcgggttgcccgattactcgagcaactggatgtgctggagggggcttctccacacctc
acggattggaacgcccaaactttacgggcacaactgatggaggaaattcgcctctggtgg
cgcaccgatgagttgcaccaatttaagccggaggtgctcgatgaggtggaatacaccctc
cactacttcaaggaggtaatttttgctgtcattcccaagctctatcgccgtctggagcag
tcattacatgaaacctttcccgcgcttcagcccccccgtcaccgtttctgccgctttggc
tcttgggtggggggcgatcgcgatggcaatccctatgtcaaaccagaagtaacgtggcaa
acggcctgctatcaacgcaacttagttcttgaggagtatattaagtccgttgagcgctta
atcaatttgctcagcctgtccctgcactggtgcgatgtgctgccggatttgctagattcc
cttgagcaggatcaacggcaactcccgagtatctatgagcagtatgcggtgcgctatcgg
caggaaccctaccgcctgaaactggcctatgtgctcaaacggctgcaaaatacccgcgat
cgcaaccgggcgctgcaaacctattgcattcgccgcaatgaggcggaagagttaaataat
ggacagttttaccgccacggtgaagaattcttggcagaactgctgctcattcagcgtaac
ctcaaggaaacgggattggcctgccgcgaattggatgatttgatttgccaggtggaggtc
tttggctttaatctagcagccttggatattcgccaagaaagtacctgtcacgctgaggcc
ctcaatgaaattaccgcctatttgggtattctcccctgtccctatacagaactctcagaa
gccgaacgcacccgctggctcctcagtgaactctcgacccgtcgccccttgattccaggg
gaactcccctttagcgatcgcaccaatgaaatcattgaaacattccgcatggtgcggcaa
ctccagcaggaatttggcaccgatttgtgcaatacctacatcatcagcatgagccatgag
gtcagcgatctgttggaggtactcctctttgctaaggaggcaggcctttttgatccagcc
actggcgctagtaccctgcaagccattcccctgtttgaaacggtggaggatctcaagcac
gccccagcggtgctgacccaactattctctctccccttttgccggagctatcttggaagc
aacagtaccccctttctgcaggaggtcatgctgggctattccgacagcaataaggattcg
ggcttcctcagtagcaactgggaaatttataaggcacaacaacagctgcagaaaattgct
gagagttttggcttccaactgcgcattttccacggtcggggtggttcagtgggtcggggt
ggtggacctgcctatgcggcgattttggcacagccagcacaaacgattaagggacgaatc
aagattactgagcagggggaggtgctggcttccaaatactcgttgccggaactcgcgctc
tttaacctcgaaacagtggccacagcggtcatccaagctagtttgctccgcagtagtatt
gatgagattgagccttggcacgagattatggaggagttggctacgcgatcgcgccagtgc
tatcgccatctcatctatgagcagccagaattcattgaattctttaacgaagtcacccca
atccaagagattagccaactgcaaattagctcacggccaacacggcgggggggcaagaaa
acccttgagagcctgcgggcaattccttgggtctttagttggacgcaaacccgtttcctg
ctgccggcttggtatggcgtgggtactgccctgaaggaattccttgaggaaaaacccgct
gagcatctctccctcttgcgctacttctactataagtggcctttcttccgcatggtgatc
tctaaggttgagatgacccttgccaaggttgatctagagattgcccgctactatgtccaa
gaactcagccaaccccaaaaccgtgaagccttctgccgcctctacgatcagattgctcag
gaatatcgcctgaccacggaattagtcctcacgattactggccatgagcggctactcgat
ggggatccggcgcttcagcgatcggtgcaactgcgcaatcgcaccattgttcctttgggc
ttcctgcaagtatctcttttgaaacggctgcgccagcacaatagccaaaccacctctggg
gcaattttgcgctcccgctatggtcggggtgaattgctgcggggggcactcttgaccatc
aatggcatagcagcggggatgcgcaatacaggctaa

DBGET integrated database retrieval system