KEGG   Tenacibaculum sp. LPB0136: LPB136_06260Help
Entry
LPB136_06260      CDS       T04588                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ten  Tenacibaculum sp. LPB0136
Pathway
ten00010  Glycolysis / Gluconeogenesis
ten00020  Citrate cycle (TCA cycle)
ten00620  Pyruvate metabolism
ten01100  Metabolic pathways
ten01110  Biosynthesis of secondary metabolites
ten01120  Microbial metabolism in diverse environments
ten01130  Biosynthesis of antibiotics
ten01200  Carbon metabolism
Module
ten_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ten00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPB136_06260
   00020 Citrate cycle (TCA cycle)
    LPB136_06260
   00620 Pyruvate metabolism
    LPB136_06260
Enzymes [BR:ten01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LPB136_06260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118
Motif
Other DBs
NCBI-ProteinID: APG64980
UniProt: A0A1L3JIL1
LinkDB All DBs
Position
1381649..1383256
Genome map
AA seq 535 aa AA seqDB search
MATVINMPRLSDTMEEGVVASWLKKVGDAIEEGDILAEIETDKATMEFESFHEGTLLHIG
VKEGETAPVDTLLAIIGEKGEDFSALLNAQAAIEETTVAKEETKDEATKSVAETPEGVQV
ITMPRLSDTMEEGTVASWLKKVGDAVSEGDILAEIETDKATMEFECFYEGTLLYVGINEG
ETAPVDSLLAVIGPEGTDVSAIVATGGTTESAPTEKTTPTEKKDETKVVETKSTTNTSTN
NSGGRIFASPLAKKIAKDKGINLADINGSGENGRIVKKDVENYTPAAKTVESSKATSSAP
TISFVASGEEKSEEVKNSQMRKAIAKSLGNSKFSAPDFSLNIEVDMDNAIASRKTINAIP
DTKVSFNDMVVKACAMALQKHPQVNTSWTDNNTVFHSHIHVGVAVAVDDGLLVPVIKHTN
QLSLTQIGAGVRDLAGKARNKKIAPAEMQGSTFTVSNLGMFGIDNFTSIINQPNSAILSV
GAIVQKPVVKDGQIVVGNTMNLTLTCDHRTVDGAVGAQFLQTLKTFIENPVTMLA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagtaataaacatgcctcgcttaagcgatacaatggaagaaggagttgtagct
tcttggttaaaaaaagttggagatgcaattgaagaaggtgatatccttgccgaaattgaa
acagataaagctactatggagtttgaatcttttcatgaaggtacacttttacacattggt
gttaaagaaggagaaactgcaccagtagatactttattagctattattggagaaaaaggt
gaagatttttcagctttattaaatgctcaagctgcaatagaagaaactacagtagctaaa
gaagaaacaaaagatgaagcaactaaaagtgtagctgaaacaccagaaggtgttcaagtt
ataactatgcctcgtttaagtgatacgatggaagaaggaactgtagcttcttggttaaaa
aaagttggtgacgctgttagtgaaggagatattcttgctgaaattgaaacagacaaagct
actatggagtttgaatgtttctacgaaggaacattattatatgttggtataaacgaaggt
gaaactgctcctgtagacagcttattggctgttattggtccagaaggaactgatgtttct
gcaattgtagcaactggcggaactactgaaagtgcaccaacagaaaaaactactccaaca
gaaaaaaaagatgaaactaaagttgttgaaactaaatcaacaactaacacttctacaaat
aattcaggtggacgtatttttgcttcaccattagctaagaaaatagctaaagacaaagga
attaatttagcagatattaatggttctggtgaaaacggaagaattgttaaaaaagatgtg
gaaaactacactcctgctgctaagactgttgaatcttctaaggctacttcttctgctcca
acaatcagttttgttgcttctggagaagaaaaatctgaagaagttaagaattctcaaatg
cgtaaagcaattgcaaaatctttaggtaactctaaattttctgcaccagatttcagttta
aatattgaagttgacatggacaatgcaatagcttctagaaaaactataaacgcaattcca
gacactaaagtatcttttaatgacatggttgtaaaagcatgtgcaatggctttacaaaaa
catccacaagtaaatacttcttggacagacaataatactgttttccatagtcatattcac
gttggtgttgctgttgctgtagatgatggtttattagtaccagttataaaacacacaaat
cagttaagtttaactcaaattggtgctggtgttagagatttagcaggtaaagcaagaaac
aaaaaaatagctcctgcagaaatgcaaggaagtacatttacagtttctaacttaggtatg
tttggtattgataactttacatcaattattaaccaaccaaattcagcaatcttatctgtt
ggtgcaattgtacaaaaaccagttgttaaagacggacaaatagttgtaggtaatacaatg
aacttaacattaacttgtgatcacagaactgtagatggtgctgttggagctcagttttta
caaacattaaaaacgtttattgaaaacccagttacaatgctagcttaa

DBGET integrated database retrieval system