KEGG   Tenacibaculum sp. LPB0136: LPB136_07230Help
Entry
LPB136_07230      CDS       T04588                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ten  Tenacibaculum sp. LPB0136
Pathway
ten00071  Fatty acid degradation
ten00280  Valine, leucine and isoleucine degradation
ten00281  Geraniol degradation
ten00310  Lysine degradation
ten00360  Phenylalanine metabolism
ten00362  Benzoate degradation
ten00380  Tryptophan metabolism
ten00410  beta-Alanine metabolism
ten00627  Aminobenzoate degradation
ten00640  Propanoate metabolism
ten00650  Butanoate metabolism
ten00903  Limonene and pinene degradation
ten01100  Metabolic pathways
ten01110  Biosynthesis of secondary metabolites
ten01120  Microbial metabolism in diverse environments
ten01130  Biosynthesis of antibiotics
ten01212  Fatty acid metabolism
Module
ten_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ten00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LPB136_07230
   00650 Butanoate metabolism
    LPB136_07230
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LPB136_07230
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LPB136_07230
   00310 Lysine degradation
    LPB136_07230
   00360 Phenylalanine metabolism
    LPB136_07230
   00380 Tryptophan metabolism
    LPB136_07230
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LPB136_07230
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LPB136_07230
   00281 Geraniol degradation
    LPB136_07230
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LPB136_07230
   00627 Aminobenzoate degradation
    LPB136_07230
   00930 Caprolactam degradation
    LPB136_07230
Enzymes [BR:ten01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LPB136_07230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: APG65153
UniProt: A0A1L3JJ81
LinkDB All DBs
Position
complement(1599088..1599789)
Genome map
AA seq 233 aa AA seqDB search
MNEVVKYQSEEKYAIIKIENGKANAISHEVVEGLNLALNKAEADKKVVILTGQAGIFSAG
FDLKIMTASPESAKELVTKGSKLSHRMLSFPMPIIVAATGHAIAKGAFLLLSADYRLGVE
GSFKIGLNEVMIGMTMHQAGIEIAKARLSSVYFERSVCNAEMYNPKDAITAGFLDKVVPD
THLLPTAIKIAEMFSQLNMKAHAGTKLKSRKPYLDKLAAAIELDLVSDISINS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtagtaaaatatcaatcagaagaaaagtacgcaattataaaaattgaaaac
ggaaaagcaaacgcaatttcacacgaagttgttgaaggtttaaacttagctttaaataaa
gcagaagctgataaaaaagtagtaattcttactggacaagcaggaattttttcagcagga
tttgatttaaaaataatgactgcttcgccagaaagtgcaaaagaattagtaaccaaaggt
tctaaattatcgcacagaatgttgtcttttccaatgccaataattgttgctgctacagga
catgcaattgcaaaaggtgcgtttttattactttctgctgattatagattaggtgtagaa
ggatcgtttaaaattggtttaaatgaagttatgattggtatgacaatgcaccaagctgga
attgaaatagccaaagcgcgtttgtcttcagtatattttgaaagaagtgtttgtaatgca
gaaatgtacaatccaaaagatgcaattacggcaggatttttagataaagttgttccagat
actcatttgttaccaacggctattaaaattgctgaaatgttttcacaattgaatatgaaa
gcacatgctggaactaaattaaaatcgagaaaaccttatttagataagttagcagctgct
attgaattagatttggtttctgatatttctataaattcttaa

DBGET integrated database retrieval system