KEGG   Tenacibaculum sp. LPB0136: LPB136_10115Help
Entry
LPB136_10115      CDS       T04588                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ten  Tenacibaculum sp. LPB0136
Pathway
ten00240  Pyrimidine metabolism
ten01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ten00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LPB136_10115
Enzymes [BR:ten01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LPB136_10115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: APG65695
UniProt: A0A1L3JKM3
LinkDB All DBs
Position
complement(2228158..2228769)
Genome map
AA seq 203 aa AA seqDB search
MFLENTVNHTEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQRIEIFKPAVDTRYDEEE
VVSHNDSRIRSTPVPASSNILLLANNVDVVGVDEAQFFDDEIVNVCNELANRGIRVIVAG
LDMDFKGKPFGPMPALMATAEYVTKVHAVCTRTGNLAHYSFRKAQSEDLVLLGETQEYEP
LSRAAYYKALREQQEKTAIKDDE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacagtaaatcatacagaacaatttggttggattgaagtaatttgt
ggctcaatgttttctggtaaaacagaagagttgataagaagacttaaacgagcacagttt
gcaaaacaacgtattgagatttttaaacctgccgtagatacgcgttatgatgaagaagaa
gttgtttctcataacgatagtagaattcgttccacaccagttcctgcatcgtctaatata
ttattattagctaataatgttgatgtagttggcgtagatgaagctcagtttttcgatgat
gaaattgtaaacgtttgtaacgaattagcaaatagaggaattagagtaattgttgctggt
ttagatatggattttaaaggaaaaccttttgggccaatgccagcactaatggcaactgca
gaatacgtaaccaaagtgcatgctgtatgtacaagaacaggaaatttagcacattatagt
tttagaaaagcgcaaagtgaagatttggttttacttggagaaacacaagaatatgagccg
ttaagtagagctgcgtattataaagcattaagagagcaacaagaaaaaacagcaataaaa
gatgatgaataa

DBGET integrated database retrieval system