KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0436Help
Entry
TepRe1_0436       CDS       T01495                                 

Definition
(GenBank) Xylose isomerase domain-containing protein TIM barrel
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00040  Pentose and glucuronate interconversions
tep00051  Fructose and mannose metabolism
tep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TepRe1_0436
   00051 Fructose and mannose metabolism
    TepRe1_0436
Enzymes [BR:tep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     TepRe1_0436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 SUB1_ProdP9 CMD
Motif
Other DBs
NCBI-ProteinID: AEE90635
UniProt: F4LUR7
LinkDB All DBs
Position
470982..471965
Genome map
AA seq 327 aa AA seqDB search
MFANISAGAWVYGTCSDRYVSDGYKDKMDFVSRVERLSNIEEVKGIEITYPFDINEENYD
HYKTLLEEKSLTISCIGVELVCDRKWKTGSFCSPHKEVREETIKLVKKAMDFANQIGVEI
VNLWLGQDGFDYLMQTNYVDAWKFLIEGLRECANHNTKVKLGLEYKASEPRLNCFLNSGG
KALAVAQATGCSNVGVTLDIGHALNAKENPAEIASILMAENKLFHLHFNDNYFIADDDMP
VGSVHFLHFVELIYWLKKLGYSGWYSLDLYPYRDDPDEACKTSIHFIRMIEKMVEKKLKD
LDFHEMAETAASKNMCNLFTKMFDMGE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaaatattagtgcaggcgcatgggtctatggaacatgcagtgaccgatatgta
agtgatggatataaagataagatggactttgtttcccgagttgaacgtttgtcaaatatt
gaggaagttaaaggtattgagattacctatccatttgacataaacgaagaaaactatgat
cattataaaaccttgttggaagagaaaagcttaaccatttcctgtattggtgttgagctt
gtatgtgatagaaagtggaagaccggttccttctgttctccacataaggaagttcgtgag
gagactatcaagcttgtaaaaaaagccatggattttgccaatcaaattggcgtagaaatt
gtaaatttatggcttgggcaggacgggtttgattatttaatgcagacaaattacgtggat
gcgtggaaattcctgatagaaggcctgagggaatgtgccaatcataatacaaaggttaaa
ctgggtttagagtataaagccagtgaaccccgtcttaactgctttttaaattccggcggt
aaagctttagctgttgcccaggcaacaggctgcagcaatgtaggtgtaactttggatatt
gggcatgctctaaatgccaaagaaaacccggcagaaattgcaagcattttaatggccgaa
aacaagctgtttcatctgcactttaatgataactactttatagctgatgatgatatgcct
gtaggcagtgtacacttcttacattttgtggaattaatctattggctgaaaaaactagga
tattcaggttggtattctcttgacctttatccatatagggatgatcctgacgaagcctgt
aaaacatccattcattttattagaatgatcgaaaagatggtggaaaagaaactaaaggat
ttagattttcatgaaatggcagaaactgcagcaagcaaaaatatgtgtaatttatttact
aaaatgtttgatatgggggagtaa

DBGET integrated database retrieval system