KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0437
Entry
TepRe1_0437       CDS       T01495                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TepRe1_0437
Enzymes [BR:tep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     TepRe1_0437
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     TepRe1_0437
    1.1.1.-  
     TepRe1_0437
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C ADH_zinc_N_2 DUF2254 DAO
Other DBs
NCBI-ProteinID: AEE90636
LinkDB
Position
471969..473027
AA seq 352 aa
MKAAVWHGYKDVRIEDVPEPKLSPDCVKIKVYWAGICGTDRHEYVGPNFIPTEKPHRLTQ
RTAPLIIGHEFTGIIVEVGGNVTGWKVGDRVTANGSLTCKSCEMCKTGRYNICSKLGFLG
VGDDGAFAEYVTVEADRLFRIPDNVTLRQGLLAEPIACGIHSTNLINDVQGKDVVVIGPG
IIGLGCFFAATLKGASKVLVAGIGDNREALIRRYNGDYVDTQKTDLAEYVKNWSNGKMAD
IVYECVGVQQTLNNAISISKPGAKIMVMGVFGQKPLISMNDLQEGERVLMTSQAHLNEIE
TALEYFSKGKIDADELITREVTLDTLVEDGFEELLKNASKHIKVAIKIVDTK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaaagctgctgtttggcatggctacaaagatgtaagaatagaagacgttcctgaaccg
aaactgagcccagattgcgtgaaaattaaggtttactgggcaggcatatgcggtacagat
cgccatgagtatgttggcccaaattttattcctacagaaaagccccatcgattaactcag
cgaacagctccattaataattgggcatgagtttacaggaatcatcgtagaggtaggggga
aatgttactggatggaaagtgggagaccgggttactgcaaatggaagtttaacctgtaaa
agctgtgaaatgtgcaaaacaggacggtacaacatttgctcaaaactgggatttctaggt
gtaggcgatgatggagcatttgccgaatatgtcactgtagaggctgataggctgttccgt
attccggataatgttacacttagacaaggcctactggctgagcccatcgcttgtggcata
cattctacaaatcttataaatgacgttcaaggtaaggatgtcgttgtcattggtcccggt
attattggattaggatgctttttcgcggcaactctcaagggcgcatcaaaagttttggtt
gcgggaataggtgataatcgggaggcgttaattcgccgttataatggcgattatgttgat
acccaaaagacagatttggctgagtatgttaaaaactggtctaatggtaaaatggcagat
attgtttacgagtgtgttggagttcaacaaacattaaacaatgcaataagcatctcaaaa
cctggagcaaaaataatggtaatgggtgtttttggccagaaaccgctgatttccatgaat
gatttacaggagggcgagcgggtgctgatgacatcacaagcccatttaaatgagatagaa
actgcattggagtacttttctaaaggaaaaattgatgcagatgaactaattacaagagaa
gtaacacttgatactcttgtagaggacgggtttgaagagcttttgaaaaacgcttctaaa
catattaaggtcgctattaagattgtagatacaaaataa

DBGET integrated database retrieval system