KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0437Help
Entry
TepRe1_0437       CDS       T01495                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
Organism
tep  Tepidanaerobacter acetatoxydans Re1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C ADH_zinc_N_2 DUF2254 DAO
Motif
Other DBs
NCBI-ProteinID: AEE90636
UniProt: F4LUR8
LinkDB All DBs
Position
471969..473027
Genome map
AA seq 352 aa AA seqDB search
MKAAVWHGYKDVRIEDVPEPKLSPDCVKIKVYWAGICGTDRHEYVGPNFIPTEKPHRLTQ
RTAPLIIGHEFTGIIVEVGGNVTGWKVGDRVTANGSLTCKSCEMCKTGRYNICSKLGFLG
VGDDGAFAEYVTVEADRLFRIPDNVTLRQGLLAEPIACGIHSTNLINDVQGKDVVVIGPG
IIGLGCFFAATLKGASKVLVAGIGDNREALIRRYNGDYVDTQKTDLAEYVKNWSNGKMAD
IVYECVGVQQTLNNAISISKPGAKIMVMGVFGQKPLISMNDLQEGERVLMTSQAHLNEIE
TALEYFSKGKIDADELITREVTLDTLVEDGFEELLKNASKHIKVAIKIVDTK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtttggcatggctacaaagatgtaagaatagaagacgttcctgaaccg
aaactgagcccagattgcgtgaaaattaaggtttactgggcaggcatatgcggtacagat
cgccatgagtatgttggcccaaattttattcctacagaaaagccccatcgattaactcag
cgaacagctccattaataattgggcatgagtttacaggaatcatcgtagaggtaggggga
aatgttactggatggaaagtgggagaccgggttactgcaaatggaagtttaacctgtaaa
agctgtgaaatgtgcaaaacaggacggtacaacatttgctcaaaactgggatttctaggt
gtaggcgatgatggagcatttgccgaatatgtcactgtagaggctgataggctgttccgt
attccggataatgttacacttagacaaggcctactggctgagcccatcgcttgtggcata
cattctacaaatcttataaatgacgttcaaggtaaggatgtcgttgtcattggtcccggt
attattggattaggatgctttttcgcggcaactctcaagggcgcatcaaaagttttggtt
gcgggaataggtgataatcgggaggcgttaattcgccgttataatggcgattatgttgat
acccaaaagacagatttggctgagtatgttaaaaactggtctaatggtaaaatggcagat
attgtttacgagtgtgttggagttcaacaaacattaaacaatgcaataagcatctcaaaa
cctggagcaaaaataatggtaatgggtgtttttggccagaaaccgctgatttccatgaat
gatttacaggagggcgagcgggtgctgatgacatcacaagcccatttaaatgagatagaa
actgcattggagtacttttctaaaggaaaaattgatgcagatgaactaattacaagagaa
gtaacacttgatactcttgtagaggacgggtttgaagagcttttgaaaaacgcttctaaa
catattaaggtcgctattaagattgtagatacaaaataa

DBGET integrated database retrieval system