KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0483Help
Entry
TepRe1_0483       CDS       T01495                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00473  D-Alanine metabolism
tep01100  Metabolic pathways
tep01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TepRe1_0483
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    TepRe1_0483
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tep01011]
    TepRe1_0483
Enzymes [BR:tep01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     TepRe1_0483
Peptidoglycan biosynthesis and degradation proteins [BR:tep01011]
 Precursor biosynthesis
  Racemase
   TepRe1_0483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEE90681
UniProt: F4LVA6
LinkDB All DBs
Position
520093..521274
Genome map
AA seq 393 aa AA seqDB search
MPKELLNIRPTWAEINLDDLRHNLLEIRRITSTNAKLCAIVKADGYGHGAVEVAQTALSC
GAHYLGVAFLDEAVELREKGIKAPILILGFTPENQFDTIIEHDITQTVYSLKSAILLSEK
ALKRKKKAKVHIKLDTGMSRIGFQTDASSISDIRKLFQLEGLKVEGILTHFAKADEKDRT
VTEEQFRIFTEAVNTIEAKDYKIPIKHIANSAGIIEYPNTHLDMVRPGIILYGMYPSDEI
TKSKIHLKPILSLKTRVAHVKSLPKGKAISYGGTYITERHTIIATLPVGYADGYSRLLSS
RAQVLINGQRAPVVGRICMDQCMVDVTDIQGEVKPKDEVTLIGADGSERIEAEDIAKIIG
TINYEITCGISKRVPRVYISNGKIQNIKNFLVK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaagaacttctaaatatcagacctacttgggctgagattaatttagatgattta
cgacataacttattggaaattagaagaattacttccaccaacgccaaattatgtgcgata
gtaaaggcagatggatacggacacggagccgtagaagttgcacagactgctctttcttgt
ggagcacattatcttggagtggcatttttggatgaagcagtagaactaagggaaaaaggc
ataaaagcacccatccttattttgggttttacacctgaaaatcaatttgatacaataata
gaacacgatattactcagaccgtatatagtctaaaatctgcaattttgctttctgaaaag
gctttaaagcgaaagaaaaaagccaaagttcatataaaacttgatacgggtatgagccgg
ataggttttcaaacggatgcatcttctatttcagatatcagaaaactgtttcagcttgag
ggcctaaaagtagaaggcattttgactcattttgcaaaggcagatgaaaaagatagaaca
gttactgaagaacaatttcgaatttttactgaagcggtaaatactattgaagcaaaagac
tacaagataccaataaagcatattgctaatagtgcgggtattatagagtatccaaataca
catcttgatatggttcgaccaggcattatcctttacggcatgtatccttcagatgaaatt
accaaaagtaaaatccatttaaaacccatactgagtttaaaaactcgagtagctcatgtt
aagtcattgccgaagggcaaagcaattagctatggtggaacatatataactgaaaggcat
accattattgcaacactaccggtggggtatgctgatggctactcaagactgctttcgtcc
cgagcccaggtactgataaatgggcaacgagctccggttgtaggacgtatttgcatggat
caatgcatggtagatgttactgacatacaaggtgaggtaaaaccgaaagatgaagttaca
ttaattggagccgatggcagcgagagaatcgaggctgaagacatagcaaaaatcatagga
actataaattatgaaataacttgtggtatatcaaaaagagtgccaagggtatatattagt
aatggtaaaatacaaaatatcaaaaattttttggtaaaatag

DBGET integrated database retrieval system