KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0644Help
Entry
TepRe1_0644       CDS       T01495                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00010  Glycolysis / Gluconeogenesis
tep00020  Citrate cycle (TCA cycle)
tep00620  Pyruvate metabolism
tep01100  Metabolic pathways
tep01110  Biosynthesis of secondary metabolites
tep01120  Microbial metabolism in diverse environments
tep01130  Biosynthesis of antibiotics
tep01200  Carbon metabolism
Module
tep_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TepRe1_0644
   00020 Citrate cycle (TCA cycle)
    TepRe1_0644
   00620 Pyruvate metabolism
    TepRe1_0644
Enzymes [BR:tep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TepRe1_0644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEE90832
UniProt: F4LW56
LinkDB All DBs
Position
694689..696008
Genome map
AA seq 439 aa AA seqDB search
MATIVKMPKLGTTMAEGAITKWLKKEGDPVRRGEIYAEIQTDKVNIEDEAPASGVIRKIL
VEEGETVPIGQPIAIIADEDEDISGYFCEQKATLQKEDDKVEHMLQQEESLSQESKPAGK
IKASPAAKRAAREHNVDLWEVAPTGPDGRIVEKDVILYIRGNKVTATPVARKIAEEKQID
LKTLKKTAGKRITKQDLFETQKPETEEFTVKYAIPVTGMRKIIAEKMAYSKKIAPHIYLS
LEVDMTKVIELRQKLSIFIQEKYNVKLSYNDILIKAAAVALRQNPIINSSFSEEEIILKE
EINIGLAVALDGGLIVPVIKNADRKGLANIASETSELIQKAKDKKLMPDDYHGGTFTISN
LGMYDIEKFSAIINQPETAILAAGKILKKPVVAEDDEIAIRPMMNLTLSCDHRAIDGAAG
AKFLQNIKQILEEPMNMLL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggctaccatagttaaaatgcccaaactcggcactaccatggccgaaggtgcaattaca
aaatggttaaaaaaagaaggtgaccccgtccggagaggagaaatatatgcagaaattcaa
acagataaagtaaatattgaagatgaagcgccggcttcaggagtaattagaaaaatcctt
gttgaagaaggtgaaaccgttcctattggacagcctatagccataatagctgatgaagat
gaagatatatccgggtatttttgtgaacaaaaggcaacattgcaaaaagaagacgacaaa
gtcgaacatatgcttcagcaggaagaatcattatcgcaagaaagcaagccagcaggtaaa
atcaaagcatctcctgcggcaaaaagggctgcaagagaacataatgtagatttatgggaa
gttgccccgacaggcccggacggtaggatagtggaaaaagatgtaatattatatatccgg
ggaaataaagtaacggctactcccgtagctagaaaaatagcagaagagaaacagatagac
ctgaaaactttaaagaaaactgccggcaagcgaataacaaagcaagacctgtttgaaacg
cagaaaccagaaaccgaagaatttactgtaaaatacgccattcccgttacaggaatgaga
aaaataattgccgaaaaaatggcttacagcaaaaagatcgcaccacacatatatctgtct
ttagaagtagatatgacaaaagttatagagcttaggcaaaaactttcgatatttattcag
gaaaagtataatgtaaagctttcatacaatgatatattgataaaagctgcagcagttgct
ttaaggcaaaatccgataataaactcaagcttttcagaagaggagataatcttaaaagag
gagataaatattggtcttgccgtagccttggacggcggcctcattgtacctgtaataaaa
aatgcagatagaaaaggtcttgcaaatatcgcaagcgaaacttcagaacttatccaaaag
gcaaaagataaaaaacttatgccggatgattatcatggaggaacttttaccatatcaaat
ctcggtatgtatgacatagaaaaatttagtgctataattaaccagccggagacggcaata
cttgcggcagggaagatattgaaaaaaccggtggtagcagaagatgatgaaatagccata
aggccaatgatgaacctgactctatcctgtgaccatcgagcaatagatggtgccgcagga
gctaaattcctgcagaacattaagcaaattcttgaagaaccgatgaatatgctgctttaa

DBGET integrated database retrieval system