KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0645Help
Entry
TepRe1_0645       CDS       T01495                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00010  Glycolysis / Gluconeogenesis
tep00020  Citrate cycle (TCA cycle)
tep00260  Glycine, serine and threonine metabolism
tep00280  Valine, leucine and isoleucine degradation
tep00310  Lysine degradation
tep00380  Tryptophan metabolism
tep00620  Pyruvate metabolism
tep00630  Glyoxylate and dicarboxylate metabolism
tep00640  Propanoate metabolism
tep01100  Metabolic pathways
tep01110  Biosynthesis of secondary metabolites
tep01120  Microbial metabolism in diverse environments
tep01130  Biosynthesis of antibiotics
tep01200  Carbon metabolism
Module
tep_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TepRe1_0645
   00020 Citrate cycle (TCA cycle)
    TepRe1_0645
   00620 Pyruvate metabolism
    TepRe1_0645
   00630 Glyoxylate and dicarboxylate metabolism
    TepRe1_0645
   00640 Propanoate metabolism
    TepRe1_0645
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TepRe1_0645
   00280 Valine, leucine and isoleucine degradation
    TepRe1_0645
   00310 Lysine degradation
    TepRe1_0645
   00380 Tryptophan metabolism
    TepRe1_0645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tep04147]
    TepRe1_0645
Enzymes [BR:tep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     TepRe1_0645
Exosome [BR:tep04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TepRe1_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_binding_2 DAO FAD_oxidored NAD_binding_8 HI0933_like AlaDh_PNT_C 3HCDH_N Thi4 RcsC Trp_halogenase UDPG_MGDP_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEE90833
UniProt: F4LW57
LinkDB All DBs
Position
696022..697404
Genome map
AA seq 460 aa AA seqDB search
MHYDIAIIGGGPGGYAAGIYAGKRKAKVALIEKCELGGTCLNRGCIPTKALIHSARLFQD
IKNAGKFGIAADNVTINWNDMQKNTVSIVKTLTKGVENLLKSNSVTVFKGTAKLADKNTI
LISDKTEQMTITADNIIIAAGSVPTILPIPGHDFQNVITSDEALFLEELPSSMLIIGAGV
IGTEIGYIYNALGTEVTIVEMLPEILPKLDDDISQELIRHLKTQGIKIYTDAKVKEIKQK
ENTLQTFFETKEGIKFIDSEKVLIAVGRTPNTAAIEKLSCNIDKKGILVNDYLQTNIENI
YAVGDITGKSMLAHVASHQGIVAIKNIMGEEHKMDYKAIPYCIYTNPEAASVGMSEKEAK
AIYKDNIKVGRFPYTANGKAMAIGEKSGFVKIIAESRYNEILGVHIIGPCATELIAEAVL
AIKLECTAEELADTIHAHPTLSEAVMEAAFDLLKEPIHKM
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcattatgatatagctattattggcggagggccgggcggctatgcggcaggcatctac
gcaggaaaaagaaaggcaaaagttgcgttaatagagaaatgcgaattaggcggcacatgc
ctgaatcgaggctgtatacctacaaaagccttaattcacagcgcaagacttttccaagat
ataaaaaacgcaggaaaatttggtattgcagcagataatgtgacgattaattggaatgat
atgcagaaaaatactgtcagtattgtaaaaacccttacaaaaggtgtagaaaatctctta
aaatccaatagtgttacggtctttaaaggcactgcgaaactagccgataaaaacaccata
ttgatatcggataaaacggagcaaatgaccattaccgctgataatataattattgctgca
ggttccgtgccaacaattttaccgattccgggacatgattttcaaaatgttataacaagc
gatgaagctcttttcttagaagaattaccctcgtccatgctgattatcggggcaggagtg
attggcacggagatcggatatatatataatgccttaggtactgaagtgaccatagtagaa
atgctgcctgaaattcttccaaagctggatgacgacatatctcaagaacttattagacat
cttaaaacacagggcatcaaaatatatactgatgcaaaagtaaaagaaattaaacaaaaa
gaaaacacgctgcaaacattttttgaaactaaggaaggtataaaatttatcgattcagag
aaagtccttatagcagtaggcaggacaccaaacacagcagcaattgaaaaattaagttgt
aatatagataaaaaaggtatacttgtaaatgattatcttcaaacaaatatagaaaatata
tatgctgttggtgatatcacaggtaaatccatgctggcacatgtggcatcgcatcaggga
atagttgcgataaaaaatatcatgggcgaggaacataagatggattataaagccatacct
tattgtatctataccaaccccgaagcggcatccgttgggatgagtgaaaaagaagcaaaa
gcgatttataaagataatatcaaagtaggaaggtttccatacactgctaatggcaaagcc
atggccataggtgaaaaatcaggttttgtaaaaattattgccgaatcaagatacaacgaa
attttaggagttcacataataggaccctgtgcaacggaactcatagcagaagctgtactt
gcaataaagcttgagtgtactgcggaagaattagcagataccattcatgcccatccaacg
ctttcggaagctgttatggaagcggcatttgatttattgaaagaaccgattcataagatg
taa

DBGET integrated database retrieval system