KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1628Help
Entry
TepRe1_1628       CDS       T01495                                 

Definition
(GenBank) Anthranilate synthase
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tep01100  Metabolic pathways
tep01110  Biosynthesis of secondary metabolites
tep01130  Biosynthesis of antibiotics
tep01230  Biosynthesis of amino acids
tep02024  Quorum sensing
Module
tep_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TepRe1_1628
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    TepRe1_1628
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TepRe1_1628
Enzymes [BR:tep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     TepRe1_1628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AEE91767
UniProt: F4LWG9
LinkDB All DBs
Position
complement(1664190..1665668)
Genome map
AA seq 492 aa AA seqDB search
MLQPSLLEAQKIAETGAYKVIPVSCEFCFDGSSPVEVLRRLKNVSKRCYILESAEGSQKL
GRYTFLGFDPVLELTCTDKKVTIHTGSFVMSESTVHPAQVIRKILEDNHSPRFDYLPPFT
GGFVGYFSYDYIRYIEPSLVLDAKDEEHFRDVDLMLFDKVIVFDNFRQKIILIVNVGCDD
IETEYERGKMELENLRELILRGSPLYELPGRMMSPICGLFNKAKYCKMVARAKEYIYNGD
VFQVVISNRFDADFDGSLLDTYGVLRKTNPSPYMFYISGDDVEIVGASPETLVTLENGAL
HTFPLAGTRPRGKTDRADKQLEAELLADEKERAEHNMLVDLGRNDIGKISEFGSVKVKKY
MSIERFSHVMHIGSDICGIIRKDRDAIDAIEAVLPAGTLCGTPKINACKIINELENIKRG
IYGGAIGYIDFTGNMDVCIAIRIAVKKNDKVFIQSGAGIVADSIPENEYQECINKAKAVV
EALETAQEGISL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaccgagcctcttggaagcgcaaaaaattgctgaaacaggagcctataaagta
atccctgtcagctgtgaattctgctttgatggcagcagtccggttgaggtattgcgcagg
ctaaaaaatgtcagtaaacgctgctatatactggagtctgctgagggtagtcagaaatta
ggtagatatacgtttcttggatttgaccctgtgctggaattaacctgcactgataaaaaa
gtgacaattcatacaggttcttttgttatgtcagagtcaacagtacatccagcgcaggtt
attcgcaagatactggaagataatcacagcccgcgtttcgattatcttcctccttttacc
ggtgggtttgtaggctacttttcttatgattacatcagatatatcgaaccatctcttgtt
ttagatgctaaagacgaggagcacttcagagacgtggacctgatgctttttgataaggtg
attgtttttgataatttccgtcaaaaaataattctaatcgtaaatgtagggtgtgatgat
attgaaacagaatatgagcggggtaagatggaattagaaaatcttcgcgaacttattttg
cgcggttcgcctctatatgaattgccaggcaggatgatgtcgccaatctgtgggctgttt
aataaagcgaagtactgcaagatggtggcaagggcaaaagaatatatatataacggggat
gtgtttcaagtagtaatatcaaatcgatttgatgcagattttgatggaagtctcctggat
acttacggcgttcttcgcaagacgaatccatcaccatatatgttttatatttccggcgat
gatgttgagattgtcggtgcttcgccggagacacttgtaacattagaaaacggtgcttta
cacacttttccactggccggaacccgaccacgcggtaaaacggatagagcggataaacaa
cttgaagccgagcttttggcagatgaaaaagaacgcgccgaacacaatatgctggtcgac
cttgggcgaaatgacataggaaagataagtgagtttggcagcgtaaaggttaaaaaatat
atgagcatagaacgtttttctcatgttatgcatataggttccgatatttgcggaattatt
agaaaagatcgagatgcaatagatgcgattgaagcggtgcttcctgccggaacactttgc
ggtactccaaaaatcaatgcatgcaaaattattaatgaattggaaaatattaaacgcggt
atatatggtggtgccattgggtatatagattttacaggtaacatggatgtctgcattgcg
attcgtattgccgttaaaaaaaatgataaagtattcattcaatcaggtgcgggtattgta
gcagacagcataccggaaaacgaataccaagaatgtatcaataaggccaaagcggttgta
gaggcacttgaaaccgcacaggagggaatcagtttatga

DBGET integrated database retrieval system