KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1923Help
Entry
TepRe1_1923       CDS       T01495                                 

Definition
(GenBank) Cys/Met metabolism pyridoxal-phosphate-dependent protein
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00270  Cysteine and methionine metabolism
tep00450  Selenocompound metabolism
tep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TepRe1_1923
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TepRe1_1923
Enzymes [BR:tep01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     TepRe1_1923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Met_gamma_lyase GDC-P Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AEE92052
UniProt: F4LQP9
LinkDB All DBs
Position
complement(1993082..1994263)
Genome map
AA seq 393 aa AA seqDB search
MGKDYGFDTLSIHGGAEKNHPKNALNPPIFMTSTYVFDDVKDAEDIMNFEKQGFIYTRGN
NPTLQLFEKRMAALEEGEDAVAFASGMAAISSVLFSLLSPKDNVVVHKTLYGSSFTVTHK
LLPKYHIDCKSVDFTEPKAVEGAIDKNTKVLYFETPANPNLAIIDIQQIVRIAKTYGVKV
VVDNTFATPYFQRPLAFGADVVVHSATKYICGHGDALGGVAVSKDADYIKKLKFDYMCEF
GGVMSPFNAWLMLRGLKTLGLRMRQHEANAMAIAEFLKSHDSIEEVFYPGLADFRGHELA
KRQMDGFGAVMSFEVKGGLKAAKRFINSVKLAKIAVSLGDCETLIELPAAMTHAGYPKAR
LQEFDLTDSIVRLSVGIENVKDIIEDLDNALKV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
ttgggtaaagactatggctttgataccctttcaatacatggaggagcagagaaaaaccac
cctaaaaatgctttaaaccccccgatatttatgacttctacatatgtttttgatgatgta
aaagatgctgaagatatcatgaactttgaaaagcaaggttttatatatacccgcggcaat
aatcccacattacagctttttgagaaaagaatggctgctttggaagagggtgaggatgct
gttgcattcgcatcggggatggcagccatatcctcggttttgttttctttgctttcaccg
aaagataatgtggtagtacacaagacactgtacggttccagctttactgtaacacataag
ctccttcccaaatatcacatagattgcaaaagcgtagattttactgaaccaaaggcagtt
gaaggggctatagataaaaatacaaaggttttgtattttgaaacaccggcaaatccgaat
cttgccatcatcgacatacagcagatagtaaggatagcaaagacttatggtgttaaggtt
gttgtggataatacctttgccacgccttatttccaaaggcctcttgctttcggcgccgat
gtggtagttcacagtgcaaccaagtacatttgcggtcacggcgatgcccttggcggtgtt
gcggtatcgaaggatgccgattacataaaaaaactgaagtttgactacatgtgcgaattc
ggcggtgttatgagtccttttaatgcttggctgatgctcaggggtttaaaaacattaggc
ttaaggatgcgccagcatgaggccaatgctatggcgattgcagagtttttgaaaagtcac
gatagcattgaagaagttttttatccgggacttgccgactttagaggccacgagcttgca
aaaaggcaaatggacgggttcggcgctgtgatgagctttgaagttaaaggcggcttgaaa
gcggcaaaacgatttataaacagtgtaaagcttgctaaaattgcagtaagtttgggcgac
tgtgaaacattgatagaacttccggcagctatgacccatgccggatatccgaaagcaagg
ctgcaggaattcgaccttacagatagtattgttagattatctgttgggattgaaaatgtt
aaggatattatcgaagatttggacaatgccttaaaagtctga

DBGET integrated database retrieval system