KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1974Help
Entry
TepRe1_1974       CDS       T01495                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00010  Glycolysis / Gluconeogenesis
tep00051  Fructose and mannose metabolism
tep00562  Inositol phosphate metabolism
tep01100  Metabolic pathways
tep01110  Biosynthesis of secondary metabolites
tep01120  Microbial metabolism in diverse environments
tep01130  Biosynthesis of antibiotics
tep01200  Carbon metabolism
tep01230  Biosynthesis of amino acids
Module
tep_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tep_M00002  Glycolysis, core module involving three-carbon compounds
tep_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TepRe1_1974
   00051 Fructose and mannose metabolism
    TepRe1_1974
   00562 Inositol phosphate metabolism
    TepRe1_1974
Enzymes [BR:tep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TepRe1_1974
Exosome [BR:tep04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TepRe1_1974
  Exosomal proteins of bladder cancer cells
   TepRe1_1974
  Exosomal proteins of melanoma cells
   TepRe1_1974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC SPK
Motif
Other DBs
NCBI-ProteinID: AEE92102
UniProt: F4LQU9
LinkDB All DBs
Position
complement(2057103..2057858)
Genome map
AA seq 251 aa AA seqDB search
MSRKPLIAGNWKMNNTKTETIKFLESFLPKAKGLSVDIVICPPFTNLFVAAEKLEGTDVK
LGAQNMHWEDKGAFTGEVSPVMLKEIPCDYVIIGHSERRQYFAETDETVNKKIKSALQHD
LLPIVCVGESLAQREEGITMSWIMSQVENALKDISSQELEKIVFAYEPIWAIGTGKTASA
ADAQEVISAIRKKIAQMYCSDTAEKVRILYGGSVKPENIKELMQEADIDGALVGGASLKP
DSFYALCTFNL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaaacccctgatagcgggaaattggaaaatgaacaatactaaaacagaaacc
attaagtttttggaaagttttttgccgaaggctaaagggctttcggtcgatattgtcata
tgcccaccctttacaaatcttttcgtggcggctgaaaagcttgaaggtacggatgttaag
ctaggggcacagaacatgcactgggaagacaaaggtgcttttaccggagaggtttcacca
gtaatgttaaaagagattccatgtgactatgtaattattggccattcggagcgccggcag
tattttgcagaaacagatgaaactgtcaataaaaagataaaatctgctctgcagcatgac
cttcttcctatagtttgtgtaggggagagccttgctcagcgtgaagagggtattactatg
tcatggataatgtcgcaggtggagaatgcattaaaagatatatcttcgcaagaattagaa
aaaatagtatttgcatatgaacctatctgggctattgggacaggcaagactgcctcggct
gctgatgctcaggaagtaatctcagccataagaaagaagattgcacagatgtactgcagt
gatactgcagaaaaggttagaatactttacggcggtagtgtcaaaccggaaaatataaaa
gaacttatgcaagaggccgatattgacggagccttggtaggcggagcaagccttaaaccg
gacagtttttatgcactttgcacctttaatctatag

DBGET integrated database retrieval system