KEGG   Taylorella equigenitalis MCE9: TEQUI_0715
Entry
TEQUI_0715        CDS       T01390                                 

Definition
(GenBank) Protein phosphatase ImpM
  KO
K11890  type VI secretion system protein ImpM
Organism
teq  Taylorella equigenitalis MCE9
Brite
KEGG Orthology (KO) [BR:teq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:teq02044]
    TEQUI_0715
Secretion system [BR:teq02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   TEQUI_0715
SSDB
Motif
Pfam: TagF_N
Other DBs
NCBI-ProteinID: ADU91653
UniProt: A0A654KGT3
LinkDB
Position
744096..744818
AA seq 240 aa
MLTKENLSSVLGWYGKMPAGGDFLYRRIPTELMDWWHKWLEQGLIYSKSRFGAEESYFHA
PIWNFAIPASNGSNYFQLGSLAPSRDRVGRIFPLLITLYLPAQYYNTQLIDGASNFYSKI
GEALRQAVSYGCPASDFEYVVSLANETFGNMLSGPQQTVAPQINSEDILSILNDGHSDDA
LMEDYSDDSYNVWYGLSEFFNPEGLNSYWWTSNITGAPYKTYIHGGVPNNTLFNVLFLQA
NT seq 723 nt   +upstreamnt  +downstreamnt
atgcttacaaaagaaaatcttagtagtgtgcttggctggtacggcaaaatgccagctggt
ggcgattttctatatcggagaattcctacagagttgatggactggtggcataagtggctt
gagcagggattgatttatagcaaatcacgttttggtgcagaggaatcgtatttccacgca
cctatttggaattttgcaattcctgcttcgaatggttcaaactactttcagcttggatcg
ttagctccttcaagagatagagttggtcgtatatttccacttctaattactttgtattta
ccagctcagtattacaatactcaattaattgatggtgcttctaatttttatagcaaaatt
ggagaggctttaagacaggctgtttcatatggttgtcctgcaagcgactttgaatacgtt
gtttccttggcaaatgaaacttttggcaatatgttgtcaggaccccaacagacagttgct
cctcagattaattctgaagacattctatcaatccttaacgacgggcactctgatgatgcc
cttatggaggattactcagatgacagttataatgtatggtatgggcttagtgaattcttt
aacccagagggtcttaatagctattggtggactagtaatataactggtgctccatataaa
acttatattcatggcggtgttcctaataacactttgttcaatgtattatttcttcaggca
taa

DBGET integrated database retrieval system