KEGG   Taylorella equigenitalis MCE9: TEQUI_0916Help
Entry
TEQUI_0916        CDS       T01390                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
teq00061  Fatty acid biosynthesis
teq00780  Biotin metabolism
teq01100  Metabolic pathways
teq01130  Biosynthesis of antibiotics
teq01212  Fatty acid metabolism
Module
teq_M00083  Fatty acid biosynthesis, elongation
teq_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:teq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TEQUI_0916
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    TEQUI_0916
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    TEQUI_0916
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:teq01004]
    TEQUI_0916
Enzymes [BR:teq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     TEQUI_0916
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     TEQUI_0916
Lipid biosynthesis proteins [BR:teq01004]
 Fatty acid synthase
  Component type
   TEQUI_0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: ADU91848
UniProt: E8UG84
LinkDB All DBs
Position
complement(939353..940138)
Genome map
AA seq 261 aa AA seqDB search
MGFLDNKKIVITGLISDRSIAYGIAKACHEQGAELAFTYVGDRFKERVQDLASGFGSDFV
ISCDVSSDDEIKNAISTIGERWGTIDGLVHSIGFATRESIAGEFLDGLSREAFKIAHDIS
AYSFPALAKEALPYLEKSQGSILTLTYLGSEKVITNYNTMGVAKAALEATVRYLAADLGP
RGVNCNAISAGPIKTLAASGIKGFGKILDYVAANAPMRRNITIEEVGNVAAFLLSPLSKG
ITGEIIHVDNGFHAVIPGMAE
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggatttctagataataaaaaaatagtaatcacaggattaatttcagaccgttccata
gcttatggcattgccaaagcatgtcatgagcaaggtgcagaacttgcgtttacatacgta
ggagataggtttaaagagcgtgtccaggatttagcatcaggatttggtagtgattttgtt
atctcttgtgatgtttcaagtgatgacgaaatcaaaaatgctatatccacgatcggtgaa
agatggggaacaattgacggacttgtacattcgataggatttgctactcgcgaatctatt
gcgggtgaattccttgacggtttaagcagagaggcttttaaaattgctcatgatatttca
gcatatagttttcctgcattggcaaaagaggcattgccatacttggagaaatctcaaggg
tccatactgaccttaacgtatctcggctccgaaaaggtaatcactaactacaatactatg
ggagtagcgaaagccgctctagaagccactgtacgctaccttgctgctgaccttggccct
cgaggcgtgaattgtaatgctatttctgcaggccctattaaaactctagccgcttctgga
atcaaaggttttggaaaaattttagactacgttgcagctaatgctcctatgcgcagaaat
attaccattgaagaagtgggtaatgtggctgcgtttcttctatcaccattgtctaaaggt
ataacaggtgaaattatccatgtggataatggttttcacgccgtcatacctggcatggca
gaataa

DBGET integrated database retrieval system