KEGG   Trichodesmium erythraeum: Tery_0836Help
Entry
Tery_0836         CDS       T00387                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00620  Pyruvate metabolism
ter00680  Methane metabolism
ter00710  Carbon fixation in photosynthetic organisms
ter01100  Metabolic pathways
ter01120  Microbial metabolism in diverse environments
ter01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tery_0836
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tery_0836
   00680 Methane metabolism
    Tery_0836
Enzymes [BR:ter01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Tery_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DnaGprimase_HBD
Motif
Other DBs
NCBI-ProteinID: ABG50249
CyanoBase: Tery_0836
CYORF: Tery_0836
UniProt: Q117S5
LinkDB All DBs
Position
1327223..1330339
Genome map
AA seq 1038 aa AA seqDB search
MSSLLHSKEITLEPGFKNPKMTASDLFLHNRIKIVENLWESVLRQECGQELVDILQKMRS
GHSPEGQASDFLGSEIEQLIEKLELKDAIRAARAFALYFQLINIVEQHYEQKIQQLAYSH
NNSLEKLISKDDIAKDHDTRSLRVESIPVWNDNRIKHEGEGTFHYLFPLLQTLNVPSQLI
QRLINNLDIRLVFTAHPTEIVRRTIRTKQRRIAKILQQLDQVNESLSESHVDEEQVNSLV
SSWKIESLKEQLTEEILLWWRTDELHQFKPSVLDEVETTLHYFNEVLFDATPELHRRFKQ
ALHSSFPYLKPPSYNFCKFGSWVGSDRDGNPFCTPAVTWQTACYQRQIVLEKYLNAIDRL
KELLSLSLHWSDVLPELLDSLDRDHIQMSEVYDQWAIRYRQEPYRLKLSYIKKRLENTRD
RNARLYNGDEVQRQKKEVLSQRQKQVLSQYQETKSIYHSSADFLAELQLIQRNLKETGLS
CSDLENLISQVEIFGFNLARLDIRQESSVHEAAIQEITEYLQILPKSYIEMSEAERTEWL
STELPTRRPLIPTELPFSEKTCEIINTFRMLRELQLEFGEEICQTYIISMSRDVSDLLEV
LLLAQEAGLYDPATGASSIHVVPLFETVEDLRSAPRVMHDLFKLSLYRAGLAGGYDKLSK
EPINELVNEAPYLQEVMLGYSDSNKDSGFLSSNWEIHKAQKALYKVGEEHGIALRIFHGR
GGSVGRGGGPAYKAILAQPGKSISGRIKITEQGEVLASKYSLPHLAMFNLENVTTAVIQA
SLLHTGFDEIETWNQIMEELAVRSRSHYRNLIYEQEDLVEFFYQVTPMPEISQLQISSRP
ARRKNDKKKTISGLRAIPWVFSWTQSRFLLPAWYGVGTALQEFVEKEPEEHLKLLQYFYV
KWPFFTTAISKVEMTLAKVDLQIAHYYVRELSKPEDRERFETLFEEITIEYHLTRNLVLQ
ISGHQRPLDGDPDLQRSVQLRNATIIPLGMLQVALLKRLRQHDTGTPGVINSRYSKSELL
RGALLTLNGIAAGMRNTG
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atgagctcactactacactcaaaagaaataaccctagaaccagggttcaaaaatcctaaa
atgacagcttcagatctgtttctacataatcgaatcaaaatagttgaaaatttgtgggaa
tcagtgctcagacaagagtgtggccaagaattggtagatatactccagaagatgcgctcg
ggtcattctccagaaggacaagcatctgactttctaggttcagaaattgaacaactgatt
gaaaaattagaactaaaagatgcaattcgggcagctcgagcttttgctctatattttcag
ctaattaatattgtcgaacaacattatgaacaaaaaattcaacaactagcttactctcac
aataacagtctagaaaaactaatctctaaagatgatatagctaaagatcatgatacccgt
tcgctgcgggttgagagtataccagtgtggaacgataacagaattaaacatgagggagag
ggtacatttcattatttatttcccctcctacagaccctcaatgtaccatcacaattaatt
caacgactaattaataatttagatatccgtttagtgtttacagcacacccaacggaaatt
gttcgtcgtacaattagaacaaaacaaagacgtatcgccaaaattctccaacagctcgat
caagtaaatgaaagcctttcagaatcacacgtagatgaagaacaagtaaattctttagtg
tcatcttggaaaatagaatccctcaaagaacagttaacagaagaaattcttttatggtgg
cgtacagatgaactacatcaatttaaacctagtgtcttagatgaagtagaaactactctt
cattattttaacgaagtcttatttgatgctactcctgaactacatcgtaggtttaagcaa
gccttacatagttcctttccttatctgaaaccaccaagttacaatttctgtaaatttggt
tcctgggtaggatctgaccgtgatggaaatcctttttgtacaccagcagtgacttggcaa
acagcttgttaccaacgtcagatagtattagaaaaatatcttaatgctattgatcgcctc
aaagaacttttgagtttatctctacattggagtgatgtgttaccagaattgttagattct
ctagaccgtgaccatatacagatgtcagaagtttacgatcaatgggcaattcgctatcgg
caagaaccttatcgtttgaagttgtcttatatcaaaaagcgtttagaaaatactcgcgat
cgcaatgcgcgtttatataatggtgatgaagttcaaagacaaaaaaaagaagttctttct
caacgacaaaaacaagttctctctcaatatcaagaaacaaaaagcatttatcactctagt
gctgattttctagctgaattacaactaattcagcgtaacctcaaagaaactggtttaagc
tgtagtgacttagaaaatctaatctctcaagtagaaatttttggttttaacttagcacga
ctagatattcgtcaagagtcttcagtccatgaagcggcgatccaagagattactgaatat
ttacaaattctgcctaaatcttatatagaaatgtcggaggcagagcggactgaatggtta
tcaacagagttgcctactcgtcgccccttaattcccacagagttacctttttctgagaaa
acctgcgaaataattaatactttccgaatgctgcgagaattacagctagagtttggtgaa
gaaatttgccaaacctatattattagtatgagtagggatgttagcgatctattagaagtg
ttgttgttagctcaagaagcaggactttatgatccggcaactggtgcgagtagcattcac
gtggttcctttgtttgagacagtggaagacttgagaagtgctcccagggtaatgcacgat
ttatttaagttgtccctatatcgtgcagggcttgctggtggatatgataaattatcaaaa
gagccaattaatgaattagttaacgaagctccttatttgcaagaggtgatgttgggttac
tcagatagtaataaagattctgggtttttgagtagtaactgggaaattcataaagctcaa
aaagctttatacaaagtaggggaagagcatggcattgctttgcgtatctttcatggacgc
ggtggttctgtaggacgtggtggcggtccagcttataaagctattttggctcaacctggt
aaaagcattagtgggcggattaaaattactgaacaaggagaggtgctcgcctctaaatat
tctctgcctcacttagcaatgtttaacttggaaaatgttactactgcagtaattcaagct
agtttgctacatacagggtttgatgaaattgaaacttggaatcaaattatggaggagttg
gcagtgcgatcgcgtagccattaccgaaatctgatttatgaacaagaagatctagtagaa
tttttctatcaagttacaccaatgccagaaattagtcaactacaaattagttcccgtcca
gctcggcggaaaaatgataagaagaaaacaatttctggtttaagggcaattccttgggta
tttagttggactcaaagtcgctttctcttacctgcttggtatggtgtgggaactgcttta
caagagtttgtggaaaaagaaccagaagaacacctaaaacttttgcaatacttttatgta
aagtggcctttctttactactgcgatttctaaagtggagatgactttagctaaggtggat
ttgcaaattgctcattattatgtgcgcgaattatccaaaccagaagaccgggaacgcttt
gagacactgtttgaagaaattactattgagtatcacctaacacggaacttagtgctacaa
atttctggtcatcaacgacctttggatggagatccagatttacagcgttctgtacaatta
cgtaatgcaactattattcctctgggtatgttgcaggtagctttgctgaaacgtctgcgt
cagcatgatacaggtacacctggtgtaattaattctcgttatagtaagagtgagttatta
cggggtgctttgttgactcttaatggtatcgctgctggtatgcgaaatacaggttga

DBGET integrated database retrieval system