KEGG   Trichodesmium erythraeum: Tery_1831
Entry
Tery_1831         CDS       T00387                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00010  Glycolysis / Gluconeogenesis
ter00020  Citrate cycle (TCA cycle)
ter00620  Pyruvate metabolism
ter01100  Metabolic pathways
ter01110  Biosynthesis of secondary metabolites
ter01120  Microbial metabolism in diverse environments
ter01200  Carbon metabolism
Module
ter_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tery_1831
   00020 Citrate cycle (TCA cycle)
    Tery_1831
   00620 Pyruvate metabolism
    Tery_1831
Enzymes [BR:ter01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Tery_1831
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3
Other DBs
NCBI-ProteinID: ABG51087
CyanoBase: Tery_1831
CYORF: Tery_1831
UniProt: Q114I7
LinkDB
Position
2795958..2797253
AA seq 431 aa
MIKEIFMPALSSTMTEGKIVSWQKTSGDWVEKGETVVVVESDKADMDVESFFSGYLATII
VEAGDVAPVGSTIGLLAETEAEIEQAKQQGVTTLNKEPANTSSSTTPVATAPISTATENQ
ENSSRRNGRIIASPRARKLAKDLKVDLSTLKGNGPHGRIVAEDVEMAAGRIPAVVAASAK
STIPTTPTQVSIPAPPPPPSVVSAPVTPGQVVPMNSLQNAVVRNMNVSLSVPTFHVGYTI
TTDNLDRLYKQIKSKGVTMTAILAKAVAITLQKHPLLNAVYVDQGIQYPSGINIAVAVAM
PDGGLITPVLPNADKMDIYSLSRTWKGLVDRARAKQLQANEYSTGTFTISNLGMFGVNRF
DAILPPAQGSILAIGASQPQVVATDDGMIGVKRQMEVNITCDHRIIYGADAAAFLQDLAN
LIENNSQSLTM
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgatcaaagaaatatttatgcctgcccttagttctaccatgaccgagggtaaaattgtt
tcttggcaaaaaacttccggtgattgggtagaaaagggcgaaacagttgtggtggttgaa
tcagacaaagcagatatggatgtggaatccttcttttctggatatttggccacaattatt
gtggaagcaggagatgtcgctccagttggatctactattggtttgttagctgaaacagag
gcagaaattgagcaggcaaagcaacaaggtgtgactactctaaacaaagaacctgctaat
acttctagctccacaactcctgtggccacagctcctatttctacagccacagaaaaccaa
gaaaattctagtcgtcgtaatggacgaattattgcttcccctcgtgcccggaagttggcc
aaagatttgaaggtcgatttgagtaccctcaaaggtaatggtcctcatggtcgtattgtg
gcagaggatgtggaaatggcggcgggtcgtatacctgctgtggtagctgcatcagcaaag
agtactattcctactactccaactcaagtatctattcctgctccaccaccaccaccatct
gtagtgtctgctccagtaactcctggtcaagttgtgccaatgaatagtctgcaaaatgca
gtggtgcggaatatgaatgtaagtttatctgtaccgactttccatgttggttatactata
actacagataatttggataggttgtacaaacaaattaagtctaagggtgtgactatgact
gctattttggcaaaagcagtggcaataaccttacaaaaacatcctttgttgaatgctgtt
tatgtggatcagggtattcagtatccctctgggattaatattgcagtggcagtagcaatg
ccagatggtggtttgattacaccagtattgccaaatgctgacaaaatggatatttattct
ttgtctcgtacttggaaaggtttggtagatagggcgcgggcaaaacaattacaagcaaat
gaatacagcactggtacctttactatttctaatttgggaatgtttggggtaaataggttt
gatgctattttaccacctgctcaaggttcgattttggcgatcggcgcatctcaaccccag
gtagtggccactgatgatgggatgattggggttaagcgacaaatggaggtgaatattact
tgtgaccatcggattatttatggtgctgatgctgctgctttcttgcaagatttggcgaat
ttgattgaaaataattcacagtctttgactatgtag

DBGET integrated database retrieval system