KEGG   Trichodesmium erythraeum: Tery_1831Help
Entry
Tery_1831         CDS       T00387                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00010  Glycolysis / Gluconeogenesis
ter00020  Citrate cycle (TCA cycle)
ter00620  Pyruvate metabolism
ter01100  Metabolic pathways
ter01110  Biosynthesis of secondary metabolites
ter01120  Microbial metabolism in diverse environments
ter01130  Biosynthesis of antibiotics
ter01200  Carbon metabolism
Module
ter_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tery_1831
   00020 Citrate cycle (TCA cycle)
    Tery_1831
   00620 Pyruvate metabolism
    Tery_1831
Enzymes [BR:ter01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Tery_1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ABG51087
CyanoBase: Tery_1831
CYORF: Tery_1831
UniProt: Q114I7
LinkDB All DBs
Position
2795958..2797253
Genome map
AA seq 431 aa AA seqDB search
MIKEIFMPALSSTMTEGKIVSWQKTSGDWVEKGETVVVVESDKADMDVESFFSGYLATII
VEAGDVAPVGSTIGLLAETEAEIEQAKQQGVTTLNKEPANTSSSTTPVATAPISTATENQ
ENSSRRNGRIIASPRARKLAKDLKVDLSTLKGNGPHGRIVAEDVEMAAGRIPAVVAASAK
STIPTTPTQVSIPAPPPPPSVVSAPVTPGQVVPMNSLQNAVVRNMNVSLSVPTFHVGYTI
TTDNLDRLYKQIKSKGVTMTAILAKAVAITLQKHPLLNAVYVDQGIQYPSGINIAVAVAM
PDGGLITPVLPNADKMDIYSLSRTWKGLVDRARAKQLQANEYSTGTFTISNLGMFGVNRF
DAILPPAQGSILAIGASQPQVVATDDGMIGVKRQMEVNITCDHRIIYGADAAAFLQDLAN
LIENNSQSLTM
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagaaatatttatgcctgcccttagttctaccatgaccgagggtaaaattgtt
tcttggcaaaaaacttccggtgattgggtagaaaagggcgaaacagttgtggtggttgaa
tcagacaaagcagatatggatgtggaatccttcttttctggatatttggccacaattatt
gtggaagcaggagatgtcgctccagttggatctactattggtttgttagctgaaacagag
gcagaaattgagcaggcaaagcaacaaggtgtgactactctaaacaaagaacctgctaat
acttctagctccacaactcctgtggccacagctcctatttctacagccacagaaaaccaa
gaaaattctagtcgtcgtaatggacgaattattgcttcccctcgtgcccggaagttggcc
aaagatttgaaggtcgatttgagtaccctcaaaggtaatggtcctcatggtcgtattgtg
gcagaggatgtggaaatggcggcgggtcgtatacctgctgtggtagctgcatcagcaaag
agtactattcctactactccaactcaagtatctattcctgctccaccaccaccaccatct
gtagtgtctgctccagtaactcctggtcaagttgtgccaatgaatagtctgcaaaatgca
gtggtgcggaatatgaatgtaagtttatctgtaccgactttccatgttggttatactata
actacagataatttggataggttgtacaaacaaattaagtctaagggtgtgactatgact
gctattttggcaaaagcagtggcaataaccttacaaaaacatcctttgttgaatgctgtt
tatgtggatcagggtattcagtatccctctgggattaatattgcagtggcagtagcaatg
ccagatggtggtttgattacaccagtattgccaaatgctgacaaaatggatatttattct
ttgtctcgtacttggaaaggtttggtagatagggcgcgggcaaaacaattacaagcaaat
gaatacagcactggtacctttactatttctaatttgggaatgtttggggtaaataggttt
gatgctattttaccacctgctcaaggttcgattttggcgatcggcgcatctcaaccccag
gtagtggccactgatgatgggatgattggggttaagcgacaaatggaggtgaatattact
tgtgaccatcggattatttatggtgctgatgctgctgctttcttgcaagatttggcgaat
ttgattgaaaataattcacagtctttgactatgtag

DBGET integrated database retrieval system