KEGG   Trichodesmium erythraeum: Tery_1972Help
Entry
Tery_1972         CDS       T00387                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
ter  Trichodesmium erythraeum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: ABG51223
CyanoBase: Tery_1972
CYORF: Tery_1972
UniProt: Q113V1
LinkDB All DBs
Position
3060023..3061867
Genome map
AA seq 614 aa AA seqDB search
MSSLNKKIKTLVDLLQHRAIQNPEKIGYSFLIDGEIETVNLTYKQLEQRSRAIAAYLQSV
CPQGEVALLLYQPGLEYITTFFGCLYAGVIAIPAYPPRPNRSLDRIQTIIRDSKAKIALT
TKSIISSLEPRASETPELENLGWLATDQIPDYFADQWLEPNINENTLAFLQYTSGSTAKP
KGVMITHQNLLHNSGLIHQCFGHSGESKGVIWLPPYHDMGLIGGILQPLYGAFPVILMSP
LMFLQSPVRWLKAISRYQGTTSGGPNFAYDLCVRKIKPEQIQTLDLSSWEVAFNGAEPIS
AEVLERFTNTFSVCGFRREAFYPCYGMAEATLIISGGNKFSPPVETKVAARALEKNQIVL
VYPTEGTKTLVGCGQTLPEQQIKIVHPEKLTLCTEGEVGEIWVSGPSIAGGYWQKPEATK
QIFAAYLAEAPGKEPFMRTGDLGFLEAGELFVTGRLKDVIIINGRNHYPQDIEWTVEQSH
PLIRPGCIASFSVEVGGEERLVVVAEVERKFRQLLERSQKSKIKSQKYESTDKSVGSVAV
GFFSERNGKSENKNSDNSQDLIKSIQRSVSINHDLQIYQILLLKPGAIPKTSSGKVQRYA
CREGFLAGTLKIFD
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtttaaataaaaaaattaaaacattagtagatttattacaacatagagctatc
caaaacccggaaaaaataggttacagctttttaatagatggagaaatagaaacagttaac
cttacctataaacaactggaacaacgttcacgggcgatcgctgcctatctccagtcagta
tgtccacaaggagaagttgccctactcctctatcaaccgggactagaatatattaccact
ttttttgggtgtctttatgcaggggttatagcaattcctgcctacccccctaggccaaat
cgttccctagaccggatccaaacaattattagagatagtaaggccaaaatagctttgaca
actaaatctatcatttctagcctagaacctcgtgcctcagaaactccagaattagagaat
ttaggttggttagctactgaccaaattccggactattttgcagatcaatggcttgaaccg
aatattaatgagaatacccttgcttttctccaatatacttctggttcgacagctaaacct
aaaggggtaatgattacccaccagaaccttttgcataattctggtcttattcatcaatgt
tttggacactctggtgaaagtaaaggagtaatttggctacctccttatcatgacatgggt
ttaattggtggaatattgcaacccttatatggggcttttcctgtcattctcatgtctcct
ttgatgtttctccaaagtccagtgcgctggctaaaagctatttctcggtaccaaggtact
actagtgggggaccaaattttgcttatgatttgtgtgtccgtaaaattaagcctgaacag
atacaaactttagacttaagtagttgggaagtagcttttaatggtgcagaacctattagt
gctgaagttttagaacgatttactaatactttttctgtatgtggttttcgcagagaagct
ttttatccttgttatgggatggctgaggctactttaattatttctgggggtaataagttt
tctccgccggtagaaactaaggttgcagctagggcattggaaaaaaaccagattgtttta
gtttacccaacagaaggaacaaaaacattagtgggttgtggtcaaactttgccagagcaa
cagattaagattgttcatccagaaaaattaactctttgtactgagggagaggtaggagag
atttgggtctctggcccaagtattgctgggggttattggcaaaaaccagaagcaacgaag
cagatttttgctgcttatttagctgaagcacccggaaaagagccatttatgagaactgga
gatttaggctttctggaggctggggaattatttgtgacgggtcgccttaaggatgtaatt
attattaatggtcgaaatcattaccctcaagatattgaatggacagtggagcaaagccat
cccctgattagaccaggttgtattgctagcttttctgtagaagttggaggagaagaacgt
ttggtagtagtagctgaggtagaacggaaatttcgtcaactccttgagagaagtcaaaag
tcaaaaataaagagtcaaaaatatgaatctactgataaatctgtgggctcggtagcagtt
ggttttttcagtgagcgtaatggtaagtctgagaataaaaattctgataattctcaagac
ttaattaaatctatccaaaggtctgtgtcaataaatcacgatttacagatttatcaaata
ttattgcttaaaccgggagctattcccaaaacttctagtggaaaagtccagcgttatgct
tgtcgcgaaggttttttagctggaactctaaaaatatttgattaa

DBGET integrated database retrieval system