KEGG   Trichodesmium erythraeum: Tery_2599Help
Entry
Tery_2599         CDS       T00387                                 

Definition
(GenBank) aldehyde dehydrogenase (acceptor)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00010  Glycolysis / Gluconeogenesis
ter00053  Ascorbate and aldarate metabolism
ter00071  Fatty acid degradation
ter00280  Valine, leucine and isoleucine degradation
ter00310  Lysine degradation
ter00330  Arginine and proline metabolism
ter00340  Histidine metabolism
ter00380  Tryptophan metabolism
ter00410  beta-Alanine metabolism
ter00561  Glycerolipid metabolism
ter00620  Pyruvate metabolism
ter00625  Chloroalkane and chloroalkene degradation
ter01100  Metabolic pathways
ter01110  Biosynthesis of secondary metabolites
ter01120  Microbial metabolism in diverse environments
ter01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tery_2599
   00053 Ascorbate and aldarate metabolism
    Tery_2599
   00620 Pyruvate metabolism
    Tery_2599
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Tery_2599
   00561 Glycerolipid metabolism
    Tery_2599
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tery_2599
   00310 Lysine degradation
    Tery_2599
   00330 Arginine and proline metabolism
    Tery_2599
   00340 Histidine metabolism
    Tery_2599
   00380 Tryptophan metabolism
    Tery_2599
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tery_2599
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tery_2599
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tery_2599
Enzymes [BR:ter01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Tery_2599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ABG51795
CyanoBase: Tery_2599
CYORF: Tery_2599
UniProt: Q111M9
LinkDB All DBs
Position
complement(4015798..4017270)
Genome map
AA seq 490 aa AA seqDB search
MVTATKPEQKVKIGPTKLLINNEWVESASGKRFETINPATGEVICNVAEADAPDVDKAVI
AARKAFTSGEWPKISAAKRGELLYKLADLIEKNIEELARLETLDNGKPFKDSLNTDLPLA
IACYRYYAGWADKVQGKTIPISGPYFCYTRHEPVGVVGQIIPWNFPLLMQAWKLAPALAM
GNTLVMKTAEQTPLSALRVGELVIEAGFPPGVVNILSGYGPTAGAAISHHKDIDKVAFTG
STEVGRLIMEAAAKSNLKRVTLELGGKSPNIVFADADMDAAIEGSHFALFFNQGQCCCAG
SRLFVEEKCYDEFVNKSVERAKLRMVGDPFTERVEQGPQVDEEQFNKVMSYIESGQQDGA
QMLCGGSRVGDRGYFIAPTVFADVQDNMKIAQEEIFGPVMSIIKFKDIDELVERANNSMY
GLAAGVWTQDVTKAHTLAHRLRAGTVWVNCYDVFDAAAPFGGFKQSGLGRELGEYGLQQY
TEIKTVTMKM
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtaactgctacaaaaccagaacaaaaagtgaaaattggtcccactaaactcttaatt
aataacgagtgggtagaaagtgcctctggcaaaaggtttgaaactattaaccctgcaaca
ggagaagttatttgtaacgttgcagaagcagatgcacctgatgtagataaagctgtaata
gcagcccgcaaagcatttaccagtggcgaatggccaaaaatctctgctgccaaacgaggg
gaacttctatacaaattggcagatttgatagaaaaaaatatagaagagttggcgagactg
gaaaccttggataatggtaagccattcaaagactctctcaatacagatctacctttagcg
atcgcttgttatcgctattatgcaggatgggctgacaaagttcaaggtaaaactatccct
attagtggcccctacttttgctatacccgccacgaaccagtgggggttgtcggtcaaatc
attccttggaattttcctctattaatgcaagcatggaaactcgctccagcattagcaatg
ggtaatacattagttatgaaaactgctgaacaaacaccattgtcagctttgcgggtgggt
gagctggtaatagaagctggttttcctcctggtgtggtcaatattttgtctggttatggc
ccaactgctggtgctgccatttcccaccataaggatattgataaagttgcttttactggt
tcgacagaagtaggtcgtttaattatggaagctgctgccaaaagtaacttaaagcgggtg
actttagaactaggtggcaagagtccaaatatagtgtttgcggatgcggatatggatgct
gctattgagggctcccattttgctttattctttaatcaaggtcagtgttgctgtgcgggt
tctcgtctgtttgtggaagagaaatgttatgatgaatttgttaacaagagtgtagaacga
gcaaaacttcggatggtaggcgacccatttactgaacgtgtggaacaaggacctcaagtt
gatgaagaacagtttaataaagtaatgagttatattgagtctggtcagcaggatggtgcc
cagatgttatgtggtggttcaagggttggcgatcgcggttattttattgcaccaactgta
tttgctgatgtgcaagataatatgaaaattgctcaagaagaaatttttggtccggtgatg
agcattattaagtttaaggatattgatgaattggtagaacgagctaacaacagtatgtat
ggcttggctgcaggagtatggacacaagatgtgactaaagctcatactttggctcatagg
ctgcgggcaggtactgtttgggtaaattgttatgatgtgtttgatgctgctgcgcccttt
ggtggttttaaacagtctggtcttggtcgggagctaggtgagtatggtttacagcagtat
acggagattaagactgtgactatgaagatgtag

DBGET integrated database retrieval system