KEGG   Trichodesmium erythraeum: Tery_3843Help
Entry
Tery_3843         CDS       T00387                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00970  Aminoacyl-tRNA biosynthesis
ter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ter00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tery_3843
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ter03029]
    Tery_3843
Enzymes [BR:ter01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Tery_3843
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Tery_3843
Mitochondrial biogenesis [BR:ter03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Tery_3843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABG52885
CyanoBase: Tery_3843
CYORF: Tery_3843
UniProt: Q10XY9
LinkDB All DBs
Position
5936030..5937514
Genome map
AA seq 494 aa AA seqDB search
MTTTVPVKTKYEAIIGLETHCQLSTQTKIFSNSSTEFGATPNTNIDPICMGMPGVLPVLN
EKVLEYAVKAGLALNCEIALYSKFDRKQYFYPDLPKNYQISQYDLPIAEHGWLEIEIVEE
DGNATRKKIGITRLHMEEDAGKLVHGGSDRLSGSTYSMVDYNRAGVPLIEIVSEPDIRSG
IEAAEYAQELRRIVRYLGVSDGNMQEGSLRCDVNVSVRPVGQKEFGTKVEIKNMNSFSAI
QRAIEYEIERQTEAIETGEKIIQETRLWEEASQCTVSMRTKEGSSDYRYFPEPDIPPIEV
STQQLDTWKAELPELPAQKRYLYESKLGLSAYDTRVLTDDFNVAKYFEAAVAAGGNSKQV
ANWVMGDITAFLKNEKISINDITLKPDNLAELVTIIDDGTISGKIAKDILPELLSKGGSP
KELVEKKGLIQISDIKAIEAIIDEVLAAHPEELAKYRGGKTKLKGFFVGQVMKKTQGRAD
PKMTNQLISKKLEG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccactgtaccagttaaaacaaagtatgaagccattattggcctagaaacccat
tgtcagcttagtacccaaactaaaattttctctaattcctccacagaatttggtgccacg
cctaataccaacattgacccaatatgtatgggaatgccaggagtattacctgtacttaat
gaaaaagttttagaatatgctgtcaaagcagggttggccctaaattgtgaaattgcactc
tacagtaaatttgaccggaaacaatatttctatccagacttacctaaaaactatcaaatt
tctcagtatgatttgccgatcgctgaacatggttggttagaaatagaaatagtagaagag
gatggtaatgcaactcgtaaaaaaattggtattactagactgcatatggaggaagatgca
ggtaagttagtccacggaggtagcgatcgcttatctggttcgacttattcaatggtagat
tacaaccgtgctggtgtaccattaatagaaattgtatcagaaccggatatccgttctgga
atagaagctgccgaatatgctcaagaattaaggcgaattgttcgctatcttggagttagt
gatggaaatatgcaggaaggttccttgcgatgtgatgtaaatgtttctgtgcgacctgtt
ggccaaaaagaatttggcacaaaggtagaaattaaaaacatgaactccttcagcgccata
caacgagcgatcgaatatgaaattgagcggcaaactgaagctattgaaacaggggagaaa
attattcaagaaactcgactctgggaagaggcctctcaatgtactgttagcatgaggact
aaagagggctctagtgactatcgttattttccagaacctgacattccacctattgaagtc
tcaactcagcagctagatacttggaaagctgaattaccagaattacctgcacaaaaacgt
tacctttatgaaagtaagttaggtttatctgcttatgatactcgtgttctgactgacgac
tttaatgtggcaaaatattttgaagcggcagttgcagcaggtggaaactctaaacaagta
gctaactgggtaatgggagatattacggcttttttgaaaaatgaaaaaattagtattaat
gatattactctaaaacctgataatttggccgagctagtcacaattattgatgatggtact
atcagtggtaaaattgctaaggatatactgccagagttattatctaaaggtgggtcgccc
aaggaattagtagagaaaaaaggcttgattcaaatttcagatattaaggcaatagaagca
attatagatgaagttttagcagcacatccggaagagttagcaaaatatcgcggcggtaaa
acaaaactcaaaggtttctttgttgggcaagtgatgaaaaaaacacaaggtcgtgctgat
ccaaagatgacaaatcaattaattagtaagaagttagaagggtaa

DBGET integrated database retrieval system