KEGG   Trichodesmium erythraeum: Tery_4217Help
Entry
Tery_4217         CDS       T00387                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ter  Trichodesmium erythraeum
Pathway
ter00473  D-Alanine metabolism
ter00550  Peptidoglycan biosynthesis
ter01100  Metabolic pathways
ter01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ter00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Tery_4217
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tery_4217
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Tery_4217
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ter01011]
    Tery_4217
Enzymes [BR:ter01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Tery_4217
Peptidoglycan biosynthesis and degradation proteins [BR:ter01011]
 Precursor biosynthesis
  Amino acid ligase
   Tery_4217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ABG53218
CyanoBase: Tery_4217
CYORF: Tery_4217
UniProt: Q10X06
LinkDB All DBs
Position
6502711..6503811
Genome map
AA seq 366 aa AA seqDB search
MTKLRVGLLFGGCSGEHEVSIRSAKVIATALTKVQNKEKYELIPIYIQKNGLWQPSDFSQ
KVLNSDHPSLLQLTNENNHDLNTSLTQQSSSPLWQIPPQAAQVDVWFPILHGPNGEDGTI
QGLLKLMQVPFVGSGVLGSAMGMDKIAMKIAFDHAGLPQVKYQVVTRSQIWSNSCVFPKL
CDDIETTLEYPCFVKPANLGSSVGIAKVRSRSELETALDNAASYDRRIIVEAGVEAKELE
CAVLGNDMPKASIVGEITYNSDFYDYETKYTEGKADLHIPARVSEAIATKIKEMATQAFL
AVDAAGLARVDFFYVEKTGEILINEINTMPGFTSSSMYPMLWEASGIPFSELVDTLIQLA
LERHSK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaattacgagtaggtttattattcggtggttgctctggcgaacatgaagtatct
attcgctctgccaaagtgatcgctactgctttaactaaggttcaaaataaagagaaatat
gaactaataccaatttacattcaaaaaaatggtctttggcaaccaagtgatttttctcaa
aaagtactaaactctgatcacccatcattgttacaattgacaaatgaaaataatcatgac
ttaaatacatccttaactcaacaaagctcttctcctctctggcaaattcctcctcaagca
gcacaggtagatgtttggtttcccattcttcatggtccgaatggggaagatggcaccata
caaggtttactaaagttaatgcaggttccttttgtgggatctggtgttttgggttcagca
atgggcatggataaaatagcgatgaaaatagcttttgaccatgcaggtttacctcaagta
aagtatcaggtagtaacacgatcgcaaatttggtcgaattcttgtgtatttcccaaattg
tgtgatgatattgaaacaactttagaatatccttgctttgtaaaacctgcaaacctagga
tcatccgtaggtattgccaaggtgcgatctcgttcagaattagaaaccgccttggataat
gctgctagttatgaccgtcgaattatcgttgaagctggtgtagaagcaaaagagttagaa
tgtgcggttttggggaatgatatgccaaaagcttctatagttggtgagattacttataat
agtgatttttatgattatgaaactaagtatacagagggaaaagcagatttacatattccg
gctcgggtgagtgaggcgatcgccactaaaatcaaagaaatggcaacccaggcattttta
gctgtggatgcagcaggtttagcaagagtagactttttctacgtggaaaaaaccggagaa
attttgatcaatgaaattaacacaatgcctggttttacttcatccagtatgtatcctatg
ctttgggaagcaagtggaattcctttttcagagttagtagatactttaattcagttagct
ttagaaagacattctaagtaa

DBGET integrated database retrieval system