KEGG   Tessaracoccus aquimaris: BW730_03260Help
Entry
BW730_03260       CDS       T04732                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
tes  Tessaracoccus aquimaris
Pathway
tes00040  Pentose and glucuronate interconversions
tes00051  Fructose and mannose metabolism
tes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tes00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BW730_03260
   00051 Fructose and mannose metabolism
    BW730_03260
Enzymes [BR:tes01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     BW730_03260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N ADH_N_assoc CoA_binding NAD_binding_7 DapB_N GFO_IDH_MocA AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AQP46690
UniProt: A0A1Q2CKV2
LinkDB All DBs
Position
698761..699807
Genome map
AA seq 348 aa AA seqDB search
MKALRYHAPGDVRIEDVEEPVCGPDEVKIRVRNCSTCGTDVKIRANGHVNITRVTTMGHE
IAGEVVEVGPDALGDFAPGDRVQVIAAIPCGECHECRKGWMEVCQNQLSMGYQFDGGFAE
YMIVPKEVLKVDGLNRIPEGVGFDEASAAEPLACAINAQEQIGIEKGDFVVVFGAGPIGC
MHIRVARGLYEAGTIVLVDINEERLKMSADAVHPDIVIDASKVDVVDEVMKLTDGRGADV
IITATPANVVQEQAVAMAARNGRISFFGGLPKTNPTITLDSNLVHYRQLHIHGANGSAPE
HHRRALEYISTGKIPVADLITEHLPLERAADALDIVAAGEAIKVTIEP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcacttcgctaccacgcgcccggcgacgtccggatcgaggacgtcgaggaaccg
gtctgcggtcccgacgaggtcaagatccgcgtgcggaactgctcgacctgcggcaccgac
gtcaagatccgcgccaacggccacgtcaacatcacccgcgtgaccaccatggggcacgag
atcgcgggagaggtggtcgaggtcggccccgacgcgctcggtgatttcgcgccgggagat
cgggtgcaggtcatcgccgccatcccgtgtggcgagtgccacgagtgcaggaagggctgg
atggaggtgtgccagaaccagctgtcgatgggataccagttcgacggcgggttcgccgag
tacatgatcgtgcccaaggaggtgctcaaggtagacggcctcaaccggatccccgagggc
gtcggcttcgacgaggcctcggccgccgagccgctcgcctgcgccatcaacgcgcaggaa
cagatcggcatcgagaagggcgacttcgtcgtcgtcttcggcgcaggcccgatcgggtgc
atgcacatccgcgtggccaggggcctgtacgaggcgggcacgatcgtgctggtcgacatc
aacgaggagcgcctcaagatgtccgccgacgccgtgcatcccgacatcgtcatcgacgcg
tccaaggtggacgtcgtggacgaggtgatgaaactcaccgacggccgcggcgccgatgtg
atcatcaccgcgacgcccgcgaacgtcgtccaggagcaggcggtcgcgatggccgcccgc
aacggtcggatctccttcttcggcgggttgccgaagactaatccgacgatcaccctggat
agcaacctggtgcactatcgtcagcttcacatccatggagccaacgggtcggctccggag
catcaccgcagggccctggaatacatctcaactggaaagatccccgtcgcagacctcatc
accgagcatctcccgctcgagagggcggcggacgcgctcgacatcgtggcggccggcgag
gccatcaaggtgacgatcgaaccctga

DBGET integrated database retrieval system