KEGG   Tessaracoccus aquimaris: BW730_03400Help
Entry
BW730_03400       CDS       T04732                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tes  Tessaracoccus aquimaris
Pathway
tes00473  D-Alanine metabolism
tes00550  Peptidoglycan biosynthesis
tes01100  Metabolic pathways
tes01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tes00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BW730_03400
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BW730_03400
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BW730_03400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tes01011]
    BW730_03400
Enzymes [BR:tes01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BW730_03400
Peptidoglycan biosynthesis and degradation proteins [BR:tes01011]
 Precursor biosynthesis
  Amino acid ligase
   BW730_03400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AQP46715
UniProt: A0A1Q2CKX0
LinkDB All DBs
Position
723280..724407
Genome map
AA seq 375 aa AA seqDB search
MRSTPVSSRKRVALIFGGQSSEHGISCLTASSVLKAIDKERFEVVGVGISATGRWSQVPL
EVIADYQIVDGVAPQVAEPDREAVWMVGENGCEVATRDGGSLVDIHGVDVAFALLHGPYG
EDGTIQGLFEMMGIRYVGSGVTASAIGMDKHFMKVAFEAAGLPVYPYVVATALRLEQDRA
HVIDEINKLSYPLFVKPARGGSSIGISRVTDPSQLDAAIAEAQRFDPKIVVEQGFIGARE
LECAVLGNPAAPLGCDASVIGEIRVQAADGFYDYEAKYFDEDGAALDAPADIPEELSERL
RRLAKQSFVAVDAEGLVRSDFFVLGDEIYINEVNTMPGFTQISMFPTLWQVGGMSYPDLV
GRLIDLALERPVGLR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaggagtacccctgtgagttcacgcaagcgcgtcgcgctgatcttcggcggccagtcg
tccgagcacggcatctcgtgcctgacggcgtcctccgtcttgaaggccatcgacaaggag
cgcttcgaggtcgtcggggtcggaatctcggcgaccggccgctggtcgcaggtcccgctt
gaggtcatcgccgactaccagatcgtcgacggcgtcgctccgcaggtcgccgagcccgac
cgcgaggccgtctggatggtcggggagaacggctgcgaggtcgccacccgcgacggtggg
tcgctcgtcgacatccacggcgtcgacgttgccttcgcgctgctgcacggcccctacggc
gaggacggcaccatccagggcctgttcgagatgatgggcatccgctacgtcggcagcggc
gtcaccgcctcggcgatcggcatggacaagcacttcatgaaggtcgccttcgaggccgcc
gggctgcccgtctacccctacgtcgtcgcgacggcgctccgcctcgagcaggaccgcgct
cacgtcatcgacgagatcaacaagctgagctacccgctgttcgtcaagcccgcccgcggc
ggctcgtcgatcgggatctcccgggtcaccgacccgtcccaactcgacgccgccatcgcg
gaggcgcagcggttcgaccccaagatcgtcgtcgagcagggcttcatcggcgcccgcgaa
ctggagtgcgcggtgctcggcaacccggccgcgccgctgggctgtgacgcctccgtgatc
ggcgagatccgcgtccaggccgcggacgggttctacgactacgaggccaaatacttcgac
gaggacggcgcggccctcgatgcccccgccgacatccccgaggagctctccgagcggctc
cggcgcctcgccaagcagtccttcgtcgccgtcgacgccgagggcctggttcgctccgac
ttcttcgtgctcggcgacgagatctacatcaacgaggtcaacaccatgcccggcttcacg
cagatctcgatgttcccgacgctgtggcaggtgggcggcatgagctaccccgacctggtg
ggccggctcatcgacctggcgctcgagcgccccgtggggcttcgctga

DBGET integrated database retrieval system