KEGG   Tessaracoccus aquimaris: BW730_12135Help
Entry
BW730_12135       CDS       T04732                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
tes  Tessaracoccus aquimaris
Pathway
tes00040  Pentose and glucuronate interconversions
tes00051  Fructose and mannose metabolism
tes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tes00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BW730_12135
   00051 Fructose and mannose metabolism
    BW730_12135
Enzymes [BR:tes01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BW730_12135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AQP48132
UniProt: A0A1Q2CPU7
LinkDB All DBs
Position
complement(2598191..2599180)
Genome map
AA seq 329 aa AA seqDB search
MANPIFGAGLWNFASYVDRYATDGYAEPVSTIEQIKLAGSVGDLSYVDLNFPYSNDASID
DIKAALDEAGLKAIGITPDIYLRRFGRGAFTNPDPTVRTQAIDLMHEAAEDVRALGARYV
KLWPGQDGWDYPFQVHHGEIWKLAKDGIRELASAHPDLKFVIEYKPREPRVKMLWDSAAR
SILGIQEIGLDNIGVLLDFGHALYGGESPADAAQLLIDHDLLWGMDVNDNLRGWDDDLMV
GSVHITEVFEFFYTLKINNWDGVWQLDQFPFREDTVETARTSIRFLKAIDRALDELDYET
LRGAQSRQDAITAQRVVQDALLSCMRSEA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccccatcttcggcgctggcctctggaacttcgccagttacgtcgaccgctac
gcaaccgacggttacgcagagcccgtctcgaccatcgagcagatcaagctcgcggggagc
gtcggtgacctcagctacgtcgacctgaacttcccgtactccaacgatgcctccatcgac
gacatcaaggcggccctcgacgaggccggcctgaaggcgatcggcatcacccccgacatc
tacctcaggcggttcggtaggggagccttcacgaaccccgacccgacggtccgcacccag
gccatcgacctcatgcacgaggcggccgaggacgtccgcgccctcggcgcgaggtacgtc
aagctctggcccggccaggacggctgggactatcccttccaggtgcatcacggcgagatc
tggaagctggcgaaggacggaatccgggaactcgcctctgcgcatcccgatctgaagttc
gtgatcgagtacaagccccgcgagccccgggtgaagatgctgtgggactccgccgcacgc
agcatcctcggcatccaggagatcggcctggataacatcggagtgctgctcgacttcggg
catgcactgtacggaggggagtcgccggcggacgcggcccagttgctgatcgatcacgat
ctcctctgggggatggacgtcaacgacaacctccgcggttgggacgacgacctgatggtc
ggatccgtccacatcaccgaggtcttcgagttcttctacacgctgaagatcaacaactgg
gatggcgtgtggcagctcgaccagttcccgttccgtgaggacaccgtcgagacggcccgc
acgtccatcaggttcctgaaggcgatcgaccgggcgctcgacgaactcgactacgagacg
ctccgaggggcgcagagccgccaggatgccatcacggcgcagcgcgtcgtgcaggacgcg
ctcctctcgtgcatgcggagcgaggcatga

DBGET integrated database retrieval system