KEGG   Tetrahymena thermophila: TTHERM_00013800Help
Entry
TTHERM_00013800   CDS       T01020                                 

Definition
(RefSeq) family 31 glycoside hydrolase
Organism
tet  Tetrahymena thermophila
Pathway
tet00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    TTHERM_00013800
   00500 Starch and sucrose metabolism
    TTHERM_00013800
Enzymes [BR:tet01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     TTHERM_00013800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 7823253
NCBI-ProteinID: XP_001008359
TGD: TTHERM_00013800
UniProt: Q22RK8
LinkDB All DBs
AA seq 901 aa AA seqDB search
MLSKSKICVILGSLLAIIGVLFLLYKSDDISVYVQGHRINKFTKHAGHYIMSSVEKESDD
GSFSVILKWKPGILEQELKISPVLKDLRATFKVDANNECEFKITDLQDSRFQLPENEPFP
FTKQRQGTKDKESNLFETEISQVGQKFYFELRRKQTQEIIFSTRNHPIYFTDKYLEISTN
LDESMIFGLGDRRTDFIIKSGKYSFWTSDAVKIDDGTPGNQLYGFHPMYLRRDIKSNQFH
VTLFRNAYGHQVDYKQHSHLTYKCIGGNIDFKFFIGDSNPETSIKLYHNYINGWVLHPFW
VQGFHQCRWGYKNSDQLMDVWNSYNKYNIPLDSLWTDIDYMYKYQDFTIDFEKFNLQQMQ
QIYNLSDPNGVHWSSIVDVGIALESDAAYRGIDMNVFIQSGRTNKTFIGKVWPGETYFPD
FNHPNSTDYWYEGLKNLTSFGLQQDGIWIDMNEFDSFVSGEIIPNQTIMDKILDYLAIAP
PSLPFNPLGMEQIDHKTLSLSAKHYSGENALLVNATNNYTITQYDVHNLNGFGEGLATYR
AAKRLGRKLTFILSRSTMFGSGRYVQHWNGDADSTWEYMRYSIPAIMNFNMYGIPFNGDD
ICGLFQDVTAELCARWQQLGSLYPFSRNHNGDNSISQEPYAFPDSPYVLSSTIKTLNIRY
QLLKFYYHLFVKANGAGTIFRPLFWQYPADNQAYQQDMQFMIGDYLMAAPVMEQGDESQQ
VTYSCFYVPQNAVFYDFYNQTQIKSGKYCQNISFDAVVPLYIRAGKIVHIQDKTTVLRSR
FLDNTFTLMVALNEDSFAEGSILTINDYNDDNNIITNCQESGNCVANILAKGQFKSTNIF
ELTLQVESESNNTNYQTIYVDKLIVSGISQNGEIYSKTIYLDQKPFVIDRDNITYQLEIQ
L
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgttaagcaagtcaaaaatttgcgtaatacttggatcgcttttagctataattggggta
ctctttttgttatacaaatcagatgatatctctgtttatgtgcaaggacatagaattaac
aagtttactaaacatgcaggacactatattatgagctcggttgaaaaagaatcagatgat
ggaagttttagtgttatcctaaaatggaaacctgggattttagaataagaattaaaaata
tctccagtcttaaaagatttaagagcaactttcaaagttgatgccaataatgaatgcgaa
tttaaaattactgatttacaggattcaagattttagttgcctgaaaacgaacctttccca
ttcactaaataaagacaaggaacaaaagacaaagaatctaatttgtttgaaacagagata
agttaggttggataaaagttctatttcgaattgagaagaaagtaaacataagaaataatt
ttttctacaagaaatcatccaatttactttacagataagtacttagaaatatctacaaac
ttggatgagtctatgatatttggtttgggtgatagaagaactgattttataattaaatca
ggaaaatactctttttggacctcagacgcagttaaaattgatgatggtacaccaggaaat
tagctttacgggtttcatccaatgtatcttagaagagatattaagagcaactaattccat
gtaactctctttaggaatgcctatggacattaagtcgattacaaatagcactctcacttg
acctacaaatgtatcggaggaaatattgactttaaatttttcataggagactctaatcct
gaaacatcaatcaaactttatcataattacattaatggatgggtactacatcctttctgg
gttcaaggtttccactaatgcagatggggatataaaaactctgatcaactaatggacgtt
tggaatagttacaacaaatacaatattcctttagattctctttggactgatatcgactac
atgtataagtatcaagatttcacaatagattttgaaaaattcaacttataacaaatgcaa
cagatctacaatttatctgatcctaatggtgttcattggagcagtatagttgatgttggt
attgctttggagagtgatgcagcttatagaggaatagacatgaatgttttcatttaaagc
ggtagaactaacaagacatttattggaaaagtatggccaggtgaaacttacttcccagat
ttcaaccatcctaattccacagattattggtatgaaggtttaaagaatcttaccagcttc
ggattataataagatggtatatggattgatatgaacgaatttgatagctttgtctctgga
gaaatcattcctaatcaaacgattatggataaaatactcgattacttagccattgcacca
ccttctcttcctttcaatcctctaggcatggaataaattgaccataaaactctttcactc
agcgcaaagcattatagcggagaaaatgcacttttagttaatgctacaaacaactatact
atcactcagtacgatgtgcacaacttaaatggtttcggagaaggattagccacttacaga
gcagccaaaagactaggaagaaagttaacttttatcttatcaagatcaacaatgtttgga
agtggaagatatgtccaacattggaacggagatgctgactctacatgggaatacatgaga
tatagtattcctgctattatgaatttcaatatgtacggaattccttttaatggagatgat
atttgcggacttttctaagatgttactgctgagttatgtgcaagatggtagcaactcggc
tcattgtacccattttctagaaatcataatggagacaatagcatttcctaagaaccttat
gctttccctgactcaccttatgtgctttcttctaccataaaaacgcttaacattagatat
taattgttgaagttctattaccacttattcgtcaaagcaaacggagcaggtacaattttt
agaccactgttctggtagtatcctgcagataattaagcttatcaataagatatgtaattc
atgataggagattatttgatggctgctcctgttatggaataaggtgacgaatcttagtaa
gtaacttattcatgcttttatgtaccataaaacgctgtcttctatgacttttacaattaa
actcaaattaaatctggtaaatattgctagaatatttcttttgatgctgttgtacctctt
tacattagagcaggtaaaatagttcatatttaagacaagaccacagtattaagaagcaga
ttcttggacaatactttcactttgatggttgctttaaatgaagatagctttgcagaggga
tccatactcactattaatgattacaatgatgataataacattatcacaaactgtcaagaa
tctggaaactgcgttgctaatattttggctaaaggttaatttaaatcaacaaatattttt
gagttaacccttcaagttgaatcagaatcaaataacacaaattattagactatctatgtt
gacaagttaatagtaagtggcatttctcagaatggagaaatttactcaaaaactatttac
cttgattaaaaaccatttgttattgatagagataatatcacttattaattagaaatttag
ctttga

DBGET integrated database retrieval system