KEGG   Tetrahymena thermophila: TTHERM_000181088Help
Entry
TTHERM_000181088  CDS       T01020                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
tet  Tetrahymena thermophila
Pathway
tet00052  Galactose metabolism
tet00500  Starch and sucrose metabolism
tet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    TTHERM_000181088
   00500 Starch and sucrose metabolism
    TTHERM_000181088
Enzymes [BR:tet01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     TTHERM_000181088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N NDUF_B4
Motif
Other DBs
NCBI-GeneID: 24437676
NCBI-ProteinID: XP_012651264
UniProt: W7XEN5
LinkDB All DBs
AA seq 906 aa AA seqDB search
MRQIQVFLTFIAISLLITTINAGYIEIEGLPGQGEYQSLLKFKKSIQDSLQHIDELQFVF
RAESKHQADIKFDDLNNKNRFSMPKTKPFDTLYQDKDKKVESEADFKFELHETGKNGFNF
QIIRSSTNEIVFSGDNEMVFSENYLKFSSKIPSNFIFGIGERNNRNFRLKNGLYTLNAID
QLHQIDEGIQGGQSVYSSHPVYLVREASGNYNVVFYKNPTPSDCIIETNKITFKSVGGII
HFKIFFGDHNPETAIRYFHEYLGGGHALPPFWAFGFHQSRWGYRNQHMIFDTIEKHKQNN
IPLDTIWSDIDYMNDKQTFTVNSVDFPESFFDKLHNELKINYIPIVDCGVGAKDYNKGNL
ALKKGIEMDIFLRSPFTGKRYKGKVWPGDSFFPDFLHPNISEYWSFMFQDFYNKTHFNGI
WVDMNEPTNFDDCMFPQNSNHECNWIDDNPYNDYKEEFIKPKFNLPFQPGNQNLQKMTLP
YNLIHYGNYTHKDVHNLYGFMDTYHTFNALRSVNKVYPFIITRSSFTGSGRFTFKWTGDN
DSNYDFLQISIPSILNYNIFGIPFVGADICGFLEHTQDQLCQRWIQLGALYPFARNHNND
QARPQEFYNLSPEVTKTASKNLKLRYSLLKHYFMLFVRTNHKGTIFRPVFFEFPYDGECF
QDRVLNQQFLLGNELMATPVVEYDKTTTSAYFPEGSWFDLLSGYKMIESKKGKFKDVYNT
LTDYVPIFLRSGKLVGMQDSKNVLKIADLNNEFNIICSLKQQNSTDQYSCTGNLLNVSNQ
SDEKEIHDECDQEVNAQSNCLLQVNIDLRVKDKILSFSVSSYQDALWKPLEDSKFKLKDI
SIRSIIMYNFPISEVSQDQLKIMKADGSVLEKGASINKYNYVYNKYIQFEKDQIVLSQIS
KFTIKL
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcgataaatttaggtatttttaacttttatagcgatttctcttttaattaccacaata
aatgctggttatatagagattgaaggtttgccaggttaaggtgaatattagtccttgttg
aagtttaagaaaagtatttaggatagtttgcaacatattgatgaattgcaatttgttttc
agagctgaatctaagcattaagcagacattaaatttgatgatttaaataataagaataga
ttttcaatgccaaaaacaaaaccttttgatactttgtattaggataaagataaaaaagtg
gaaagtgaagctgattttaaatttgaacttcatgaaactggcaaaaatggtttcaatttt
taaataattagaagttcaacaaatgaaatagttttcagtggagataatgaaatggtattt
tctgaaaattatctcaaatttagtagcaaaattccttctaacttcatctttggtattggt
gaaagaaacaacagaaatttcagattaaaaaatggattatacactttaaacgcaatcgat
caattgcatcaaatagatgaaggtatttaaggaggttaaagtgtttatagttctcaccca
gtttatctagtaagagaagcatcaggaaattataatgttgtcttctacaaaaatcctact
ccttccgattgtatcatagaaaccaacaaaatcacatttaaatctgttggtggtataatt
cactttaaaatattctttggtgatcacaatccagaaactgcaatcagatatttccatgaa
tatttaggtggtggccatgctctccctccattctgggcctttggatttcatcaaagtaga
tggggatacaggaatcagcacatgatttttgatacgattgaaaaacataagtaaaataat
atccctcttgacacaatttggtctgatattgattatatgaatgataagtaaactttcact
gttaactctgttgattttcctgaatcatttttcgataaacttcacaatgagttgaaaatt
aattatattcctattgttgactgtggagttggagctaaagattacaacaaaggcaactta
gctttaaaaaaaggaattgaaatggatatatttttaagatccccatttacaggtaaaaga
tacaaaggaaaggtgtggccaggtgattcttttttccctgactttttgcatccaaatatt
tcagagtattggagcttcatgttttaagatttttacaataagactcattttaatggaatt
tgggttgatatgaatgaaccaacaaattttgacgattgcatgtttccttaaaattctaac
catgaatgcaattggattgatgataatccttataatgactataaggaggaatttatcaaa
ccaaaattcaatttaccattttagcctggtaaccaaaacttgtaaaagatgactcttcct
tataatttgattcattatggtaactacacccataaagatgttcataatttatatggcttt
atggatacttatcatacatttaatgctttgaggagcgtcaataaagtgtatccttttatt
attactcgtagtagcttcactggatctggtcgctttactttcaaatggacaggagataat
gactcaaattatgactttttatagatatctattccttcaatccttaattataacattttc
ggtataccttttgttggtgctgacatttgtggctttttagaacacacataagaccaactt
tgccaaagatggatatagttaggtgctttatatccttttgctagaaatcacaacaatgat
caagcaagaccttaggaattttataatttatctccagaagtaactaaaacagcatctaaa
aacttgaagttgaggtattcactactcaaacactactttatgcttttcgttagaacaaac
cacaaaggtactatatttagacctgtattttttgagttcccttatgatggtgaatgtttt
taagatagagttctaaatcaataatttttgctcggaaatgaattaatggcaaccccagtt
gttgaatatgataaaactaccacttcagcttatttcccagaaggatcatggtttgattta
ttgagtggatataaaatgattgagagcaaaaaaggtaaatttaaagatgtttacaatact
ttgactgattatgtaccaattttcttaagatctggtaagttagttggtatgcaagactcg
aagaatgtattaaaaatagcagatttaaataacgagttcaatataatttgctcattaaag
tagtaaaattctacagattaatactcttgcacaggaaatttgcttaatgtttcaaattag
tcagatgaaaaagaaatacatgatgaatgcgattaagaagttaatgcttaatctaattgt
ttattgtaagtaaacattgatttgagagtaaaagataaaattttatcattcagtgttagt
agctattaagacgcattgtggaaacctttggaagattcaaaattcaaacttaaagatatc
agtattagatcaattatcatgtacaatttccctattagtgaagtaagtcaagattaactg
aagataatgaaggctgatggaagcgtattagagaaaggtgcttctattaataagtataat
tatgtgtataacaaatacatttaatttgaaaaggattagatcgttttatcttaaatatcc
aaatttacaattaagctttga

DBGET integrated database retrieval system