KEGG   Tetrahymena thermophila: TTHERM_00047080Help
Entry
TTHERM_00047080   CDS       T01020                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tet  Tetrahymena thermophila
Pathway
tet00020  Citrate cycle (TCA cycle)
tet00190  Oxidative phosphorylation
tet01100  Metabolic pathways
tet01110  Biosynthesis of secondary metabolites
tet01130  Biosynthesis of antibiotics
tet01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TTHERM_00047080
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TTHERM_00047080
Enzymes [BR:tet01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TTHERM_00047080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 7844993
NCBI-ProteinID: XP_001014703
TGD: TTHERM_00047080
UniProt: Q23DI3
LinkDB All DBs
AA seq 636 aa AA seqDB search
MFKYLSKIQRVTLHSKVSKNFAVLSKDHPEKGPSQGHLTDKYTVIDHTYDAIVVGAGGAG
LRAAFGLVEEGFKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWKWHFYDTVKGSDWL
GDQDAIQYMTREAPAAVLELESYGLPFSRTPEGKIYQRAFGGQSLKFGKGGQARRTACAA
DRTGHAMLHTLFGRSLAYNCNFFIEYFVIDLIMDEEGACRGVICMSMADGSIHRIRAHYT
VLAAGGYGRSYLSCTAAHTCTGDGMALATRAGLPLEDPEFVQFHPTGIYGSGCLMTEGCR
GEGGILVNSNGEAFMEKYAPTAKDLASRDVVSRAMTIEILEGRGVGPKKDHIFLQLHHLS
PETLHQRLPGISETARIFAGVDVTKEPAPVVPTVHYNMGGVPTNWKTEVITQDKNGKDKI
VPGLLAAGENACASVHGANRLGANSLLDIVVFGRAAAKLVKEKLKPGTPHKDLPKNAGEQ
ALARLDKYRFANGEYTTHHVRTAMQETMQRHAAVFRIEKLMAEGVQKLDHIYEQSKSLKT
FDRGLVWNTDLIETLELENLLLCSKQTLLAGLLRKESRGAHARDDFKERDDKNWMKHSLT
WIKDVNTGKTEVTYRDVINHTLDSEVTPVPPAKRSY
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatacttatctaagatataaagagttaccttacacagcaaagtttcaaagaat
tttgcagttttgtcaaaggatcatcccgaaaagggaccttcccaaggtcatttgactgac
aaatacactgtcattgatcacacctatgatgctatcgttgttggtgctggtggtgctggt
ttaagagctgcttttggtttggttgaagaaggtttcaagaccgcttgtattactaagctt
ttccctactcgttctcacacagtcgctgcttaaggtggtattaacgctgctttaggtaat
atgacagaagatgactggaaatggcatttttatgatacagttaagggttctgattggtta
ggtgattaagatgctatctaatatatgactagagaagctcccgctgccgtcttagaatta
gaatcttacggtcttcccttctctcgtactcctgaaggcaagatctatcaaagagccttc
ggtggtcaatccctcaagttcggcaagggtggttaggcaagaagaactgcttgtgcagct
gatagaactggacatgctatgttacatactttattcggaagatccttagcttataattgc
aatttctttattgaatatttcgttattgacttaattatggatgaagaaggtgcctgcaga
ggtgtcatctgtatgtctatggctgatggttctattcacagaatcagagcccattacact
gtattggctgctggtggttacggtagatcttatctttcttgcactgctgctcacacctgc
actggtgatggtatggctcttgctactagagctggacttcctcttgaagatcctgaattc
gtttaattccatcctactggtatctacggttctggttgtttgatgaccgaaggttgcaga
ggtgaaggtggtatccttgttaacagtaatggtgaagctttcatggaaaaatatgctccc
actgctaaggatcttgcttccagagatgtcgtctctagagctatgactattgaaatcctt
gaaggtagaggtgttggccctaagaaggatcacattttcttataattacatcacttgagt
cctgaaactttacattagagattacctggtatttctgaaactgccagaattttcgcaggt
gttgatgttaccaaagaaccagctcctgtcgttcctaccgttcactacaatatgggtggt
gttcccactaactggaagactgaagttattacccaagacaagaatggaaaggacaagatt
gttcctggtttgcttgctgctggtgaaaacgcttgtgcttctgtccacggtgctaacaga
cttggtgctaactctcttttagatattgtcgttttcggtagagctgctgccaaacttgtt
aaggaaaagcttaaacctggtactcctcataaggatttacccaagaatgctggtgaataa
gctttagccagattagataaatacagatttgctaatggtgaatacactactcaccacgtt
agaactgctatgtaagaaaccatgtaacgtcacgcagctgtcttcagaattgaaaagctt
atggctgaaggtgttcaaaaattagatcacatttatgaataatcaaagagccttaaaacc
ttcgacagaggtcttgtttggaacactgatctcattgaaaccttagaattagaaaacctt
cttttatgctctaaataaactcttctcgctggtttactcagaaaggaatccagaggtgct
cacgccagagacgattttaaggaaagagatgataagaattggatgaagcacagtctcact
tggattaaagatgtaaatactggtaaaactgaagtaacctatagagatgtcatcaaccac
actcttgatagtgaagttactcctgttcctcccgctaaaagatcatattga

DBGET integrated database retrieval system