KEGG   Tetrahymena thermophila: TTHERM_00059350Help
Entry
TTHERM_00059350   CDS       T01020                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
tet  Tetrahymena thermophila
Pathway
tet04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:tet00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    TTHERM_00059350
Enzymes [BR:tet01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TTHERM_00059350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 7841888
NCBI-ProteinID: XP_001007667
TGD: TTHERM_00059350
UniProt: I7M6X2
LinkDB All DBs
AA seq 257 aa AA seqDB search
MLTLLSKFIQTKSDIYLEQIFNFLVTKFYIKISQKILLKIARQIQTNKQTNLSKKHILKS
RMLVKSVLLGAAGTALFSYSNQKTYKAEKNAGERIAIAILYPAPGYDVTGAVTFYQKDLH
SKTQITARLKNLNPNGLFGFHIHEFGDLTNGTESVGPHYNPFNKKHGSPREDESHMGDLG
NIKADDLGYGYYTSENNKVTLFGEYSVVGRSVLVNKNEDDLGRGNHPDSHTNGHSGPRIA
AGIIGLAYELKNLPARF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccttattatcaaaatttatacaaacaaagagtgatatttatttagaacaaatt
tttaattttctagtaactaaattttatatcaaaataagttaaaaaattcttttaaaaata
gctagatagatacaaacaaacaaacaaacaaacttaagcaaaaaacatattttaaaaagt
aggatgttagtaaagagtgttttgttaggagctgctggtacagccttattttcatattct
aattaaaagacatacaaagctgaaaaaaatgcaggagaaagaatagctattgcaatatta
taccctgctccaggatatgatgttactggtgctgttactttctactagaaagatttacat
tcaaaaacttaaattacagctcgtcttaaaaatttaaatcctaatggactatttggtttt
cacattcatgagtttggtgacttgactaatggaacagaatctgttggtcctcactataat
ccatttaataaaaagcacggaagtcctagagaagatgaatctcatatgggtgatttaggc
aatattaaagcagatgatcttggttatggttattatacttctgaaaataataaagttact
ttatttggagaatattctgttgttggtagaagcgtattagttaataagaatgaagatgat
ttaggtagaggcaaccacccagactcccatacaaatggtcactctggtcccagaatagct
gctggtattattggacttgcttatgaacttaaaaacttgcctgctagattttga

DBGET integrated database retrieval system