KEGG   Tetrahymena thermophila: TTHERM_000628579Help
Entry
TTHERM_000628579  CDS       T01020                                 

Definition
(RefSeq) inositol-triphosphate type 1 protein
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
tet  Tetrahymena thermophila
Pathway
tet04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tet00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    TTHERM_000628579
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tet01009]
    TTHERM_000628579
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tet04040]
    TTHERM_000628579
Protein phosphatases and associated proteins [BR:tet01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TTHERM_000628579
Ion channels [BR:tet04040]
 Ligand-gated channels
  IP3 receptor
   TTHERM_000628579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RIH_assoc Ins145_P3_rec
Motif
Other DBs
NCBI-GeneID: 24439898
NCBI-ProteinID: XP_012653918
UniProt: W7XAT4
LinkDB All DBs
AA seq 3584 aa AA seqDB search
MRTQQEKQYSPLYNQTQVDQSNIDLLNRDSQQIPPKLPLNLIVSARQSQFLLKGLNQSQI
NRSQRIITPNMNAEIKTQATDEQNNYQQQQQINQQNQGNLFIPRYNSQTYIDNTTNSKQG
YQQIKLPDLVNFMGYDRKKEMHINLNQKDPLLFGSIISLNPFEEPMKFIMSDGFVKNQAY
IKDLSFDGSGSVFDRCLFKVYPSFKSKYLRELLEKSKDFEKTKRNTTNPIFRKQTTESKF
YTSKKEKSEQQKQQDFEANVMQEYKHNMDVFEKLKGTPVSYNQELQLLHVASNTFLTCNF
IQSEIENQNFGLELQQFSSKSTIFKIQPCYTHQQRTEGIVLLKDVVYITSAASYLGRQPY
LHSSKVQEQLKDNDLDNKQGKYNKSQNDFLNERPKINQLGTGNSFTTTNNDQKNKVNLQQ
QNNFTLQKNNTLTVPSQIEIYEDKNHDENLKSYQELYQNQSQQKSQNIGFEQSSDQNQEQ
TQTINSINDDHQLISNIFMQTQLQKQYSKRNTLGAKDNTQTNQQGNYRGLSKIQRSFIEN
TGEKQQQDRRTTQMIQKENQLQQQNTLKTGNDAQPTNTTIQQKEKDIICFADKNSSNQEA
NASLEQKTKWRIILYANTCGQQDFLQYGDVIWLNHVETGFTIISKKSENTYNNYNYVTVD
SSSKKDQSSKYEGNTNGMWIIENENFTQGGLMTWEDRFFLRNFSSGKYLSLNPCMSNLEQ
ATFKVSEFPDVLSLFMFTPISTADRQKDMIYIAKDSFFFIKSIYLKGWIHIRQKQEESAL
TNTGQYQNQFIKGSLLLKIKYQQPLDDDAFKVIRATMTEVLEANFLISCFPILRQSLFKL
QKVKGKEVQVLQNSQEYADLQRNLSLLKSCLEDLDKFCKNQIITTSLDYESSNYGKLNYS
RQKVLYEQYYIDIVIQLLKELLSKSELENLKKIRITDIKVKIADKIKNCLVKQNNSINLQ
LLEDQLIKKHQKSSPKRVLSKQDSEALYNAVSGAQDRHRKFHINYIKFKLSIVKVAYQLL
TSICKQNPQNERYLFDKKIKDIKYQAKFLKEAIDSIIQIIGNNEKIINDLCDDIRIAERK
RRNNDNQKGLLFGNQIKNQMFFNDAISNQLSVGIGRNSEQLASPLTIKQNENAQSVEETL
KLDNILVFFVNLARDSLDKRNPNILKFFRTICSYKRKGVSVNQEIMYKFLDNIPGFEQQL
LIEMKLDELQQMVIKFSDQRQVILDEKLLGKDQDVEINSKLQYLIQQIEFFSDLCLGRNY
LWSNKMMSIFPFDYITKQIQENSLHEQARSAFCNLALSLYIDQEPLNEISRPQMCRIYSN
YKQKEVEQMPSIYSTTDLVNFQSANNENSFEAKRESFSKLLTFSIEYLQNEIKQIITKYD
EIQSKLNQLNPDNQNSSRIRGIMNWSNKYTAPLDNNVEQYQMENRLSSALTFNIVKMLVT
MIKLNVLTILQKSDQYTLIISNLVKLFEYDYQNYNITLSLSKKREERYEKQMNIIQENKL
IAGIKGIQKKLKEAAAEVVEKTTKYTQKTFKYVGKFMGITYKKRKIIEEEILQFNENFFS
SNPLVGGLVSLMQMIKQGDEDQNKDVKKLQIEISTKLEICEILLFCQSHRMDFLIANFLG
WFDKLGKSDKFKNITDYQQYQKTLEQVIQEDLSTVIPNVCKTGIEFLDLLYKPLEKKNII
NKQLEKMWKGQLLIEQQKRNKPKKFEVYTDQSEIYIPDLDTLITGKKDSIISSEILPSLL
TTFYLTGDSVLEDKILEVIFNQSTQTEKLFQYLQNLEILFQRQDILPFKFLQVQIHKLRF
LTERSEIWLNNYFQQTQIGGNEIKELNEIIKILHNIDSLFFSSTRANENGTLIISRFFRE
YQTQLSKQTNPYFIEQIQQECNQELDRTRQKIFTFLQGHNPIIQMIKNSQNQMVKFVKQQ
DVSADSKIKIVQLLRYLYSILVHFCYNIEDNQKILAKPEYLSLFFDEISIDFGQFDLLNA
IYFNNKPLCSSFPDSLLNQIKTAINQFGRQPRFIQILKIIQSYKSQDQSVTLHLIENQIR
VFRWFIPSEFLEKDEVSEYSYLLYGQLDENQSLNFDLSLHNNQIDDEVDQFLLNQGDKKE
DDLKNSSEFHYNKKNFMLDAPFYYHAMLLDIFIHSIDGDEGYNLNINKIKKMFSLQYIFK
FLLKEDDFLSQSPINIPHMFQDQQQLNPLFQDQHLQERSLYDKSVLYLVKTQEEGFSLIK
PKALILIRKAYLNPSSPHLESLLRELNNIIYFIRIEINRFRQAPLDKEDFLIERYLEYFC
EGFIEFSSAYLKAIAKNGDELEDIKEREDILLFHEMVQTLVARRVFVHQRCTSYQLALIM
DFIKNCYKVIGEQDFLTQFKNIDSQVIPSPAKRKICNKDENAYYEGSLKLDFVDSSLQWI
SSQNWSIFLGICCNSSILHEQKENELSSLAQALINVENLYDRKIVFKDFLKKLISFVKNG
IVNQVQIKNIKNILRLFEKILELQDNNQKLVEMQNIFDQLDAAIMVLTLISDIKENPFED
DKVLLNLFNFMNKLLQGGNKKVQKTIYNFFINHPKSEIIFQTFYTILLEQIEKLKEINKQ
EQESSQAAKLLLEKQIENQNKRKKNKSMSQPSSPGLNQKKRNKLKNGDESPQFNFESPPD
KILENQELKLETNQEEKIENSSQDIYKQDLLISLLNLLQLFCEGHYLPLQNYLRFQSQNR
NSYDIITITVELLDQLKLKKSNFKNMIICFDLLTKFVQGPCHENQEKIIDSKFLEIAYQI
LNTEISNKNSKQGLHNDQEQNQTTNNFKSQLFHKDESHRNKKNQNSLVVLSRKETVQVDN
YQSQYLINQLQAKTITNFDRLNFNENNLSQKQEQFINNLDKWQLQNLKYKIMIVINSLLE
FNHDSEVVKRIMRSLPLFTLKNNITAIFKRYKKIYQDQYVKQSLGHAQTDPPKFNSKQQR
KYYELITETGFYIYFLISCYIELPSNSSEKNRNINQDLDLQTINELSEIQKDFKESKGSI
FDLEQNIIGKFTKFLYAILSWMYQQVKFITQKINIAKSQKQHLDETEAKYFKEGIQFFKR
NSASIEIVRNNQIEKVRFIKYPYCHFLPKDIKSQFQENVIRDSIHTKIQTVIDKYKKVID
ICKHEEKLSLFFNRNKIVSIFANYVDMWREIAYIITVTLNIFIIISYSELNVDKNKPSNL
EPEISSETRWDMRTMNPLLGLTDRYLSVQDTRDLFALFGFIMVFCSMFIMVFFLVKRGPL
YLKQAWVSSESFIDKSSGFFIKMLVYIFVIITTILKLLINLEIIYYLSFGLLAILATFVH
PFFFAFHLTECFLRYQTLRNVLKSIYDPKIGLILIFILILLFMYFFTVFGYLIFNDSYSN
RCDSLYLCFFESFDQNYKYIGGLGGFLNRVKPQDTDNYDYERFLFDNFCYILISIFLSKM
FSGLIICTFKQLRDTQMQKHIDVNEMCFICGNSRELFDRKSDKGFQQHIKNDHYIWNYMF
YLAYLEERDSTEYTGVESYVKEKLTQLDYTWFPIQRASVLVDDEKKILRDQKELEELQNK
LNKYNNQMKEVTILNNIILENCSSQQQNQKQLQKQDIKTANEIK
NT seq 10755 nt NT seq  +upstreamnt  +downstreamnt
atgagaacatagcaagaaaaataatattctcctctttacaatcaaacataggttgatcaa
agcaacatagatttattaaatagggattcccaacagattcctcctaagttaccactaaat
ctgatagtatctgcaaggcaaagccaatttttgttaaaaggactaaactaatcttaaatt
aatagatcataaagaattattacaccaaatatgaatgctgaaataaaaacataagcaaca
gatgagcaaaacaattattaataataacagtaaataaattaatagaattaaggaaatctc
ttcatacctcgatataattcatagacttatattgataataccacgaattctaaataaggt
tattagcagataaagctaccagatttagtcaattttatgggatatgataggaagaaagaa
atgcatataaatttaaattaaaaggatcctttactttttggctctattatttctcttaat
ccatttgaagaacccatgaaattcattatgtcagatggatttgtcaaaaattaagcttac
atcaaagatttatcttttgatggtagcggatctgtgtttgatagatgtttattcaaggtg
tatccttcatttaaatctaaatacttaagagaactacttgaaaaatcaaaagactttgaa
aagaccaaaaggaacacaacgaatccaattttcagaaagcagacaaccgaatctaaattt
tacactagtaaaaaagaaaagagtgaacaacaaaagtagtaggattttgaagcaaatgtt
atgtaagaatacaagcacaacatggatgtatttgaaaaattaaaaggaactcctgtgagc
tataattaagaacttcaactactacatgttgcttctaatacttttctaacttgcaacttt
atttaatcagaaatagagaactaaaattttggattagagttgtaacagttttcttctaaa
agcacaatttttaaaatacagccatgctatacacatcaataaaggactgaaggtatagtt
ttattgaaggatgttgtttacataacatcagctgcaagttatttaggtagatagccttat
ttgcatagttcaaaagtataagaatagttaaaagataatgaccttgataataagtaaggg
aaatataataaatcataaaatgatttcttaaatgagaggcctaaaattaatcaattggga
acagggaactcctttacaacaacaaataatgattaaaaaaataaagtaaatttacagtaa
taaaataatttcacgctataaaaaaataacactcttactgttccttcctaaattgaaatt
tatgaagataaaaaccacgatgaaaatttaaaaagttactaagaactttactaaaattaa
tcttagcagaagtcttaaaacattggatttgagcaaagttctgactaaaattaagaataa
acacaaacaataaatagtattaacgatgaccactaattaatatcaaacatttttatgcaa
actcaactctaaaaataatattctaaaagaaatactttaggagcaaaagacaatacttaa
acgaattaataaggtaattataggggtttatctaagatttaaagaagtttcatagaaaat
actggagaaaaatagtaataagataggagaacaacttaaatgatttaaaaagagaattag
ttataatagtaaaacaccttaaagactggtaatgatgctcagccaacaaatacaactatt
taataaaaagaaaaagatattatctgttttgcagacaaaaattcttcaaattaagaagca
aacgcctctttagaataaaaaaccaaatggagaataatattatatgcaaatacatgtgga
tagtaggattttctgtaatatggtgatgtgatttggcttaatcatgttgaaactggattt
actatcatatctaaaaaatcagaaaatacctataacaattataattatgttacagtagac
tcaagttcaaaaaaagattaatcttccaaatatgaaggaaatacaaatggtatgtggatt
attgagaacgaaaattttacttaaggcggattaatgacatgggaagatagatttttttta
agaaatttctcatctgggaaatacttaagcttaaatccatgtatgtcaaacttagagtaa
gcaacttttaaagtttctgaatttccagatgttttatctttatttatgtttactccgatt
agcacggcagatagataaaaagatatgatttacattgctaaagactcattcttttttatc
aaatcaatctacttaaagggttggatacatattagataaaaataagaagaaagtgcatta
acaaatactggttagtattaaaattaatttataaagggaagcttgcttttgaaaataaaa
tattagtagcctttggacgatgatgcttttaaagttatacgtgctactatgactgaagtg
cttgaggctaattttctcataagctgttttcctattttgaggtagtctttatttaaatta
caaaaagttaaaggaaaagaggttcaagtgttataaaactcttaagaatatgctgatttg
caaaggaatttatctcttttaaaaagttgtttggaagatttagataaattctgtaaaaat
tagataataacaacttcgttagattatgaatcttctaattatggaaagctaaactacagc
agatagaaggtattgtacgaatagtattacattgatatagtgatttagcttcttaaagaa
cttctttcaaagagtgaattagagaatttaaagaaaattagaataaccgatatcaaagta
aaaattgctgacaaaattaaaaattgcttagttaaataaaataacagcattaatttgtaa
cttttagaagattagcttattaaaaagcattaaaaatcttcacccaaaagagtactctca
aagcaagattcagaagctttatataacgctgtttctggtgcataagatagacaccgcaaa
ttccatataaattatataaaattcaaactttctattgtcaaagtggcatattaactcctt
acttctatttgcaaataaaatccttaaaatgaaaggtatttgtttgacaaaaaaataaaa
gacataaagtattaggcaaaatttttaaaggaggcaatcgacagcataattcaaattata
ggtaacaatgaaaaaatcattaacgatttatgcgacgatatcagaatagcagaaagaaaa
cgaagaaacaatgacaattagaaaggattgctgtttggaaactaaataaaaaattagatg
ttcttcaatgatgccataagcaattaattgagtgttggaataggcagaaacagtgagcaa
ttagctagtccattgacaataaaacaaaacgaaaatgcataaagtgtagaagaaacgctt
aaattagataatattttagtcttttttgttaatttagcaagagacagcttagataaaaga
aatcctaatatattaaaatttttcagaacaatatgttcttacaaaaggaaaggagtttca
gttaattaagaaattatgtacaaatttttggataacataccaggcttcgaatagcaacta
cttattgaaatgaagcttgatgagctacaataaatggtaataaaattctctgattaaagg
caggtgattttagatgaaaaattgcttggtaaggattaagatgtagaaataaactctaaa
ctctagtatttaatttaataaattgaatttttctcagatttatgcttgggccgtaattat
ttatggagtaataaaatgatgtcaatctttccatttgattatataactaagtaaatttaa
gaaaactcgttgcatgaataagcaagaagtgctttttgtaatttagctttgagtctttat
atagactaagaaccgttgaatgaaataagtagaccttagatgtgtcgaatttatagtaat
tataagcaaaaagaggtagaacagatgccatctatttattctacaacagatttggtaaat
ttttaaagtgcaaataatgaaaacagttttgaagctaaaagagaatccttttcaaagtta
ctaacattttcaatagaatacttgcagaatgaaattaaataaattattaccaaatatgat
gaaatctagtccaaacttaaccaattaaatccagataattaaaatagcagtagaattaga
ggaataatgaattggagtaataaatacactgctcctttagataataacgtagagtagtat
taaatggaaaatagattgtcaagtgctttaacatttaatatagtaaaaatgcttgttact
atgattaaactgaatgttctaacgattttgtaaaagagtgaccaatataccttaataatc
agcaatcttgttaaactatttgaatatgactattaaaactataacattactctatctttg
agcaaaaaaagagaagaacgatatgaaaagcaaatgaatatcatacaagaaaataaatta
atagctggtattaaaggaattcagaaaaaattgaaagaagcagcagcagaagtagttgaa
aaaactaccaaatacacccagaaaacttttaaatatgttggaaaattcatgggaataact
tacaaaaaaagaaaaatcattgaagaggaaattcttcaatttaatgaaaattttttctct
tctaatcctcttgtaggaggtcttgtaagcttgatgtaaatgattaagcaaggagatgaa
gattagaataaagatgtcaaaaaattataaatagagatcagcacaaagctcgagatttgt
gaaatacttttattctgttaaagccacagaatggatttcttaatagctaattttcttggc
tggtttgataaattagggaaatctgataaatttaaaaacatcacagattactagcaatac
taaaaaactttagaataagtgatttaagaggatttgagtactgtcattcctaatgtttgt
aaaacagggattgaatttttagatcttttgtacaagccgttagaaaagaaaaacataata
aataaatagcttgaaaagatgtggaaaggatagctacttattgagtagtaaaagaggaat
aaacctaaaaaatttgaagtttacacagattaaagtgaaatttacattccagatcttgac
actttaatcacaggaaaaaaagacagcataatatcatctgaaattttaccttctctttta
acaactttctatctaactggtgacagtgttcttgaagataaaattttagaagtaattttt
aatcagtcaacctaaactgaaaaactcttttagtatctctaaaatttggaaattcttttt
tagagataagacatccttcctttcaaatttctttaagtacaaattcacaagctaagattt
ttaacagagaggtcagaaatttggttgaataactatttttagcaaacataaattggaggc
aacgaaatcaaggaattaaatgaaattattaaaattttacataacatcgattctctattc
ttttcatcaacaagggctaatgaaaatggtaccttaattatttcaaggtttttcagggag
tattaaactcaactatctaagtaaacaaatccttattttattgaacaaatacagcaagag
tgtaatcaagaattagataggacaagataaaagatatttacattcttacaagggcataat
cctattatttaaatgattaaaaactcctaaaattaaatggtaaaatttgtgaaatagtaa
gatgtatcagctgactctaaaattaaaattgtttaactactaagatatttgtattctatt
ttagtacatttttgctacaacatagaagataattagaaaatattagcaaagccagaatat
ttaagtctcttttttgatgaaatttctattgattttggataatttgatttattgaatgca
atatactttaacaacaaacctctctgttcttcatttcctgattctttactaaattagata
aagacagccattaattagtttggaagataaccaaggtttatttaaattttgaaaattata
caatcctataaaagctaagattaaagtgtaactctccatttgatagaaaattaaattaga
gttttcagatggtttattccatcagaatttctagaaaaagatgaagtaagtgaatatagt
tatcttttatatggttaattagatgaaaatcaaagtttaaactttgatttatcacttcat
aacaactaaattgatgatgaagttgactagttcttattaaatcaaggtgataaaaaagaa
gatgaccttaaaaatagcagtgaatttcattataataaaaaaaactttatgctagatgca
ccattttattatcatgctatgctgcttgacatatttattcactcgatagatggagatgaa
ggatataatttaaatataaacaaaattaaaaaaatgttttcgttgtaatatatatttaaa
tttcttttaaaagaagatgattttctttcataatctccaatcaacatacctcatatgttt
taagactaataataacttaaccctcttttttaggactaacatttgtaagagcgctctctc
tacgataagtccgtcttatacttagtaaaaacataggaggaaggtttttcgttaattaaa
cctaaagctctgatcttaataagaaaggcttatttaaatccttcaagcccacatttggag
agcttattaagagaattgaataatattatctactttataaggatagagattaatagattt
agataggcacctttagacaaagaggattttcttattgagagatatttagaatatttttgt
gaaggctttattgaatttagctcagcatatttaaaagcaatagcaaaaaatggtgatgaa
cttgaagatataaaagaaagagaagatatattactattccatgaaatggtttagacatta
gttgcaagaagagtttttgttcattaaagatgtaccagctattaacttgctttaattatg
gatttcataaaaaattgctacaaagttataggcgaataagattttctaacacagtttaaa
aatatagatagctaagttatcccctcacctgcaaagagaaagatttgcaataaagatgaa
aatgcatattatgaaggcagtttaaaattagattttgtagatagcagtttacagtggatt
tcatcttagaattggtcaatatttttaggtatttgctgcaatagttcgattttgcatgaa
caaaaagaaaatgagctttcttcattagctcaagctttaataaatgtagaaaatttgtat
gatagaaaaatagtcttcaaagattttctaaaaaaattaatatcttttgtaaagaacggt
atagttaattaagtgtaaataaagaatattaaaaatattttgaggctatttgaaaaaatt
ttggaattgtaagataacaattaaaaattagttgaaatgtagaacatttttgattagctg
gacgctgctatcatggtactgactttgatatcagatatcaaagaaaatccctttgaggac
gataaagttttgttgaatctatttaattttatgaacaaacttttgtagggaggaaataag
aaagtttaaaaaacgatttataatttttttatcaatcaccctaaaagcgaaattattttt
taaacattctataccatattacttgaataaatagaaaagttaaaagaaattaacaaacaa
gaataagaaagttcttaagctgctaagttgcttttagaaaaataaattgaaaattaaaat
aaaaggaagaaaaataaatcaatgtcttaaccttcaagtcctggtctcaattaaaaaaag
agaaataaacttaagaatggagatgaatcaccttaatttaactttgaaagtcctccagat
aaaattttagaaaattaagaactcaaattagaaactaactaagaagaaaaaattgaaaat
agctcacaggatatttacaaataagacttattaatttctctactaaatcttttacaactc
ttttgtgagggacactacttacctctgtaaaattatttaagatttcaatctcaaaacagg
aactcttatgatatcatcacaattacagttgaattgcttgattaacttaagctcaagaaa
tctaactttaagaacatgattatttgttttgacttattaacaaaatttgtctaaggtcct
tgccatgaaaatcaagaaaaaataattgattcaaaattccttgagatagcttattaaatt
ttaaatacagaaataagcaataaaaattcaaaataaggtctccacaatgattaagaataa
aattaaacgacaaataatttcaagagctaattattccataaagatgagtctcatagaaat
aaaaaaaatcaaaatagtttggtagtcttatcaagaaaagagactgtttaagttgataat
tattaatcatagtatttgattaattagctttaagctaaaacaatcactaattttgataga
ttaaatttcaatgagaataatctttcccagaaataagagcagtttattaataatcttgat
aagtggtaactacaaaatcttaaatataaaatcatgatagttattaacagtttgcttgag
tttaaccacgattcagaagtcgttaaaagaattatgagatctctacctttatttactctt
aaaaataatattacagcaatctttaagagatataaaaaaatttattaagactaatatgtt
aagcaatctctaggtcatgctcagactgatccacctaaatttaattcaaaacaatagaga
aagtattacgaattaattacagaaactgggttttacatttactttttaatcagttgttac
atagaattaccatcaaattcttcagagaagaatcgaaacataaattaagatctagatttg
tagacaataaacgaactaagtgaaatacagaaagatttcaaagaatctaaaggaagtatc
tttgatcttgagtaaaacattataggaaaatttacaaagtttttatatgcaatattgagc
tggatgtattaacaagtcaagtttataacataaaaaattaacattgctaaatcacaaaag
caacacttagatgaaacagaagctaagtatttcaaggagggaatataattttttaaaagg
aattcagcttcaattgaaatagttagaaataatcaaatagagaaggtaagatttataaaa
tatccttactgtcacttccttcctaaagatataaaatctcaattttaagaaaatgttata
agagattctattcatacaaagatataaactgtcattgacaagtataagaaagtgattgat
atttgtaagcacgaagaaaaattaagtctgttctttaacagaaataaaatagtaagcatt
tttgctaactatgtagacatgtggagagaaatagcttacataataacagttactttaaat
attttcattattataagttactcagagttaaatgtagacaagaataaaccttctaatcta
gagccagaaatttcttcagaaactagatgggatatgagaaccatgaatcctttactaggg
ttaacagataggtatctttctgtttaagatacaagagatctctttgctctctttggtttt
attatggtattttgttctatgtttatcatggtcttctttttagtcaagcgtggacctctc
tacctcaaataagcatgggttagtagcgaatcatttattgataaaagttcaggttttttt
attaagatgctagtttatatttttgtaatcataactaccattctaaaattgttgattaat
ctcgaaattatatactacttatcttttggtttattagctattttagctacttttgtgcat
cctttcttttttgcttttcatctaacagaatgctttctgagatattaaactttgagaaac
gtattaaagtcgatttatgatcctaaaataggacttatattaatctttattttaatttta
ctatttatgtatttctttactgtgtttggctacttaatattcaacgactcttactctaat
agatgtgacagtctttatctctgtttttttgaatcttttgattagaattacaaatatatt
ggaggattgggaggtttcctcaatagagttaaacctcaggatacagataattatgattat
gagaggttcttatttgacaacttttgctatatattgatttcaatatttctttctaaaatg
ttttctgggctaattatttgtacgtttaagtaactaagagacacttaaatgtaaaaacat
attgatgttaatgaaatgtgttttatttgtggaaattcaagggagctttttgatagaaaa
agtgataaaggattttaacaacacattaaaaatgatcactatatttggaattatatgttt
tatcttgcttatttggaagaaagagatagcactgagtatactggtgttgagtcatatgtg
aaagaaaaattaacttagcttgattatacttggttccctatataaagagcgagcgtttta
gtggatgatgagaaaaagattttaagggattaaaaagaattagaagaacttcaaaataaa
ttgaataaatataataattaaatgaaggaagtaactattttaaataatatcatattggaa
aattgtagctcttaatagtaaaactaaaagtagttataaaaacaagatataaaaactgct
aatgaaataaagtga

DBGET integrated database retrieval system