KEGG   Tetrahymena thermophila: TTHERM_00411610Help
Entry
TTHERM_00411610   CDS       T01020                                 

Definition
(RefSeq) alpha amylase domain protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
tet  Tetrahymena thermophila
Pathway
tet00500  Starch and sucrose metabolism
tet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TTHERM_00411610
Enzymes [BR:tet01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     TTHERM_00411610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase GHL6 GHL10
Motif
Other DBs
NCBI-GeneID: 7825464
NCBI-ProteinID: XP_001020855
TGD: TTHERM_00411610
UniProt: I7LW22
LinkDB All DBs
AA seq 486 aa AA seqDB search
MSKLQFVLIAALLLVAVSAKTAQEWKTRNIYQIITDRFALGDGSKPYCDLNKQPYYCGGN
FKGIENNLDYIQGMGFNAIWISPVPDNYPNQFHGYAAKNMTEINSHFGGADGLKSLIDAC
HKRDIWVMIDVVANHMGNTDQNYSENIPFNSPDHYHSYCIISDSDFATKNMYNIQHCRLA
GLADLNQENSYVSNYLVNWIKDLVQTYNVDGIRIDTVPEVHPDFWKQYTTSAGVFATGEV
FDGDFGYVASYIPSVGSVLNYPWYFNMRDIFVNQKDMWGVRTYYQNWANQHADLSILTPF
VDNHDNPRFLSDQVFNNGKDRNTRIQLLKGYTTFTLTSIGIPILYYGTEQYFSGNTDPYD
REPLWNSLNTNSDMYKYVQSILYAKNITNAGLQGQTEAYCDQDLYAFFRGKLFVGVTSKF
NQVTRQIVTHPFSNGEVICNIFYPTQDCLTITNNSFNLVLIGGEAKIFVPKSLLQKSSQF
LRSASS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaactctaatttgtattaattgctgcacttcttcttgttgcagtctctgctaaa
accgcttaggaatggaagacacgtaacatttatcaaatcatcactgatagattcgctctt
ggtgatggatctaagccatactgtgatttaaataaataaccctactattgtggtggtaac
ttcaagggtattgagaacaatcttgactacattcaaggtatgggtttcaatgctatttgg
atctctcctgttcctgataactaccccaactaattccatggttatgctgccaagaacatg
actgaaataaacagccattttggtggtgctgatggtcttaaatctcttattgatgcatgc
cacaagagagatatctgggttatgattgatgttgttgctaaccacatgggtaacaccgat
taaaactactctgaaaatattcccttcaactctcctgatcactatcactcttactgtatt
atttctgattcagatttcgcaactaagaatatgtacaacattcaacactgcagacttgct
gggcttgccgaccttaactaagaaaattcttatgttagcaactatcttgttaactggatt
aaggatcttgtttaaacctacaacgttgatggtattagaatagacactgtccctgaagta
caccctgacttctggaaataatatactacctctgctggtgtttttgctactggtgaagtt
tttgatggtgattttggatatgttgccagctacattccctctgttggctcagtcttgaac
tatccttggtactttaacatgagagatatcttcgttaaccaaaaggatatgtggggagtt
agaacctattactaaaattgggctaattaacacgctgatctttctatccttactcctttc
gttgataatcacgataatcctcgtttcttatctgatcaagtcttcaataatggtaaagac
agaaacactcgtattcaactcttaaagggatacacaactttcactcttacatctattggt
attcctattctttactacggtactgaataatacttctctggtaatactgatccttatgac
cgtgaacctttgtggaacagcttaaacactaactctgatatgtacaaatatgtccaatct
attttatatgctaagaacatcactaatgctggattataaggataaactgaagcttattgt
gaccaagatttatatgctttcttcagaggtaaattgttcgttggtgtcacttctaagttt
aattaagttacaagacaaattgttactcatcccttctcaaatggtgaagttatttgcaat
attttctatcctacttaagattgccttacaattactaataactccttcaaccttgttctt
attggtggtgaagctaagatctttgttcctaaatctctcctctaaaaatcaagttaattt
ttgagatctgcttctagttga

DBGET integrated database retrieval system