KEGG   Tetrahymena thermophila: TTHERM_00437650Help
Entry
TTHERM_00437650   CDS       T01020                                 

Definition
(RefSeq) DNA polymerase type-B family protein
  KO
K02350  DNA polymerase zeta [EC:2.7.7.7]
Organism
tet  Tetrahymena thermophila
Brite
KEGG Orthology (KO) [BR:tet00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tet03400]
    TTHERM_00437650
Enzymes [BR:tet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     TTHERM_00437650
DNA repair and recombination proteins [BR:tet03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    TTHERM_00437650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B zf-C4pol
Motif
Other DBs
NCBI-GeneID: 7843623
NCBI-ProteinID: XP_001017761
TGD: TTHERM_00437650
UniProt: I7M8A7
LinkDB All DBs
AA seq 1739 aa AA seqDB search
MNLRFQIYDGHISYFMHFYSDNYIYGMKEVYAINYKFRKDFSENNANIFQKLSLNQIAKG
QMKQNLYNYEFDLLEIYEEFPEYFSRQQKSSTCYIEADVESKNLINFIYHCDKDKEDDES
SDDEANQSQKNNFQMLSLDKNPFLKYTHFERGKVLSFEITVQITKAIKELWLEENRRRQI
FQINSPNTIRISLENNIEGSLEFRTGRCDIYNSVNHMNDEKVRKQFNQHILQYFQKSQTK
LKDPDEIFLNLNVIQNFFKQKQNQKNEIYSKVVSRFEDYKTRKKGILEMLLQQNDEEAED
KYLKKQLDKQSIDFEVYMGDGDEDPEVCLSDKEEEEEKEMIDLEDILKDNQLLKSSTENK
NAFDVIQSNAMKKPNHVAFWRNRYKVDKNNLKQNVDSIFDVCKYCNQPVHICRCQVEINK
SLKDKPFLFPEETFFEQPINSNQLYFETFQFTYSKKPPPFEAIVKNFQQSNSFFEHQYPY
YENMVDLFDHYQMKNKNVVNKLQQAQILSHGLIKAPINKLYACDIKNELKLPKFFRIYLT
DDYESFKISMYDNKQTFKYQQQPPSYQQILKDFQNQTPQQPSRLTDEFNIISPFKDKSPI
KTRNSLNQKSPIQNKFVGDITLMLVEIFARSSPHKLPNPATDSVDALFFSIYNGKFDVSP
RYFNSEEQKAIQGMIIVDPINFSYLQENEVNFKAFYQTNENISEIIVVENEEDLIQVFII
ITQKIDPDIFGGWDMEKSSLNYLGQRCQILGIQLFELLSRCPSNINKLIQVLQFNSFQTQ
NDEFSVFSNDTLNFNSSLSSFSQLNQSFQSDSLPDQSPIPNEGQQVDSKQKGRLRINSLD
LYQSTSISSSISIKPSKMKRTLSADSQVLVSIPELNQEHQVKFFAAENEETEEDPQKEIL
TSQNSNSLSSSISKHIQSKQKNKVFEMDLSSPSFHSSNKSQNQHFSQKSQFSQQGMLYQG
TQYSFIQTSHSKKKEFDLNSQKKFDVNLKEDSKMSKKTQSNQSSIKQQNDPQSAQQKENI
KELRRGQLYHNLNLKIRGRIIWNIWRLCRDKLKLTNFDAENVYYELFQIRNPVYSNWTLT
KWFNSESAKHKTLVFDYYFNKLKINQIVLDKLDIIQRTTSSARLYGCDFESIITRGSQFR
VEGVLVRVTKQYGYLMLSASRMQVASQKILECMPLVMEPPKMLFVDPVIVMDFQSLYPSV
MIAYNYCYSTCLGNINEQFNNGGSGRLGVNQDAHLKFEQLFGKDRKFNPKDMDQYHQDIF
IAPNKVAYVRKTIREGILPQILHEFLLTRIMIKKSAGFYKDDKYLSKLLDAQQQSIKLFM
CVVYGYTGASFSGRMPSVDIADSIVETGRYLLNQVCEYINSNKDWYAKVVYGDTDSVFVL
LKGRSVEEAFRIGKEIAESITKQYPYPIELKFEKVFRELILVSKKRYVGYKMEKITDKPE
FLAKGIEIVRRDGCDAVVKLMKKSLNILFETKNLSKLKNYLNKQWAKILHGHVNFKDFCI
AKEVKLGKYKEDRVPAHGIVGLKITEQDQLAKPKYGERVKYLVVQGEQKSKVKDLVVSVP
EFFNKFNHQMNSLYYINRQINSSIGRLFSTFDVDIKDWFFNMPKGKIKVNFLKNHQFIQQ
RQSKTQDLRSQLHIENYYRLEVCIICYERCSEDICNSCLSDIPTLSYLLSHKQQIIHSQY
QEIERKCKNCSSLENKEIEEVPCVEYNCPYLYAKKYSKDNLDYLSKIISKYLNIINESF
NT seq 5220 nt NT seq  +upstreamnt  +downstreamnt
atgaatctaagattctaaatttatgatggtcacatcagttactttatgcatttttatagt
gataactacatttatggaatgaaagaagtgtatgcaataaactataaatttagaaaagat
tttagtgaaaacaatgctaatatttttcaaaagctttctcttaattaaattgctaaagga
taaatgaaataaaatctttacaattatgaatttgatctcttggaaatatacgaagagttt
cctgaatacttttctaggtaatagaaatcttcgacttgttatatagaagcagatgttgaa
agtaaaaatctgattaattttatttatcactgtgataaagataaagaagatgatgaaagc
agtgatgatgaagctaattaaagttaaaaaaataacttttaaatgctttctttagataaa
aatccttttcttaaatacactcattttgaaagagggaaggttcttagttttgaaataact
gtgcaaatcacaaaagccattaaagaattgtggttggaagaaaatagaagaagataaatt
ttttaaataaactcccctaacacaatacgaatttctctagaaaataacattgagggatca
ttagaatttaggacaggtagatgtgatatatacaattctgtaaatcacatgaatgatgaa
aaagttaggaaatagtttaaccaacacattttacagtatttctaaaagtcgcaaactaaa
ttgaaagaccctgatgaaattttcttaaacttgaatgtgatttagaattttttcaagcaa
aaatagaattaaaaaaatgaaatttattctaaagtagttagtagatttgaagattacaaa
actaggaaaaaaggtattttggaaatgctcctttagcaaaatgatgaagaagccgaagat
aaatatcttaaaaagtagcttgataagcaatcaatagactttgaggtgtatatgggtgat
ggagatgaagatcctgaagtgtgcttatcagataaagaagaggaagaagaaaaagaaatg
atagacctagaagatatcttaaaagataattagctattaaaatctagtacagagaataaa
aatgcttttgatgtgatataatcaaatgcaatgaaaaaaccaaatcatgttgctttctgg
agaaatcgctacaaagtcgataaaaataatttgaagtagaacgttgattctatttttgat
gtatgtaaatactgtaactaacctgttcatatttgtcgatgctaggttgaaattaataaa
tcacttaaagataaaccatttttatttcctgaggaaactttttttgaatagcctataaac
agcaattagctttattttgaaaccttttaatttacatattcgaagaaaccacctcctttt
gaagctattgtcaaaaatttttaataatcaaactcattctttgagcatcaatacccttat
tacgaaaatatggttgatttatttgatcactatcaaatgaaaaataaaaatgtagtcaac
aagctataataagctcaaatcttaagtcatggattgataaaagctcctataaataaacta
tatgcatgtgatattaaaaatgaattaaaattacctaaatttttcaggatatatttaact
gatgactatgaatcgtttaaaatatcaatgtatgataataaataaacgttcaaatatcaa
tagcaaccaccttcatattaataaatcttaaaagatttttagaattaaactcctcaataa
cctagtcgacttactgatgagtttaacattatttcaccattcaaagataaatctccaata
aaaactagaaattctttaaatcaaaaatcaccaatttaaaacaaatttgtcggagatata
acactaatgctcgtagaaatatttgcaagaagttcacctcacaaactgcctaatcctgcc
actgattcagttgatgccttattttttagtatttacaatggaaaattcgatgtttctcct
cgatactttaacagtgaagaataaaaagcaattcaaggaatgataatagtagatcctata
aattttagctatttgtaagagaatgaagttaacttcaaagcattttattaaacaaacgaa
aatatcagtgaaattatagttgtagaaaacgaagaagacttaatttaggtatttataatt
attacctaaaaaatagatccagatatatttggtggatgggatatggaaaagagttcttta
aattatttaggctaaagatgctaaatacttggtatttaactattcgaattattaagtaga
tgcccttcaaatatcaataaattaatttaagtattacaatttaattcttttcaaacttag
aatgatgaattttctgttttttcaaatgatactctaaactttaattcttcattgtctagc
ttcagtcaacttaattaaagtttttagagtgattctttacctgattaatctcctatacca
aatgaaggttagtaagtagacagtaaataaaaaggaagattaagaataaacagcttagat
ttatattaaagtactagcataagctcatctatttctataaaaccttctaaaatgaaaaga
acactttctgctgatagttaagttttagtttctatccctgaattaaatcaagagcattaa
gttaaattttttgctgctgaaaatgaagaaactgaagaagatccttaaaaagaaatttta
acaagctaaaattcaaattccttaagctcttcaatttcaaaacacatttaatcaaagtaa
aaaaataaagtttttgaaatggatttatcttcaccttcattccattcttcaaataaatct
taaaattagcatttttcataaaaatcataattttcatagtagggaatgctctactaaggt
actcaatatagctttatccaaacatcacactctaaaaagaaggaatttgatttaaattca
cagaaaaagtttgatgtaaatttaaaagaagattctaaaatgagcaaaaaaacttaatct
aatcagagttcaataaaacaacaaaatgatccttaatctgcttaataaaaagaaaatatc
aaagaattacgaagaggttaactttaccataatttaaatttaaaaataagaggaagaatc
atttggaatatttggagattatgtagagataaattaaaattaactaattttgatgcagaa
aatgtgtattacgaattattttaaataagaaatccagtttatagcaactggacacttact
aaatggtttaatagtgaatcagctaaacataagaccctagtatttgactactactttaat
aaattaaaaattaatcaaatagtcctagataaacttgatataatataaagaactacatct
tctgctcgcctttatggatgcgatttcgagagcattataacaagaggatcttaatttagg
gtagaaggtgttttagttagagtaactaaataatacggatatttgatgctttctgcaagt
agaatgcaagttgcttcttaaaaaatacttgagtgtatgcctttggtcatggagcctccg
aaaatgctttttgttgatcctgttattgttatggattttcaatctctttacccttcagta
atgattgcttataattattgttattctacctgtttgggaaatattaatgaacagtttaat
aatggaggaagcggaagactcggtgttaactaagatgcacacttaaaatttgaataatta
tttggaaaagatagaaaatttaatcctaaagatatggatcaataccatcaagacatattt
atagccccaaataaagtagcttatgttagaaaaactataagggaaggaattctaccataa
atattgcacgaattcctactcacaagaattatgattaaaaaatcagctggattttataag
gacgataaatatttaagcaaattacttgatgcttaatagtagtctataaaactttttatg
tgcgttgtttatggatatactggagcatctttttcaggtagaatgccttctgtagatata
gcagattctattgttgagacaggaagatatcttttaaaccaagtgtgcgaatacattaat
agcaataaagactggtatgcaaaagttgtatatggtgatacagactcagtatttgtttta
cttaaaggtagaagtgtggaagaagcctttaggataggtaaagagatagcagaatcgatt
acaaagtaatatccttatccgatagaactaaaatttgaaaaagtatttagagaattaatt
ttagtttcaaaaaagagatatgttggatataaaatggaaaaaattactgataagcctgaa
tttttggcaaaaggcattgaaatagtaagaagagatggttgtgatgcagttgttaaatta
atgaaaaaaagtttaaacattctttttgaaacaaaaaatttatccaaattaaaaaattac
ttgaataaacaatgggcaaagatacttcatggtcatgttaattttaaagatttttgtatt
gcaaaagaagttaagttaggaaaatacaaagaagatagagtacctgcacatggtatagta
ggattaaaaataacggaataagattaattagcaaaacctaagtatggagaaagagttaaa
tatctggtagtacaaggtgagcaaaaaagtaaagtaaaagacttggttgtatcagttcca
gagtttttcaataaatttaatcatcaaatgaatagcttgtattacataaacagataaatt
aattcatccataggaagattgttttcaacttttgatgtggatataaaggattggtttttc
aatatgccaaaaggcaagattaaagtgaatttcctaaaaaatcattaatttattcaacaa
agataaagcaagacctaagatttaagaagtcagttgcatatagaaaactactatcgatta
gaagtatgcataatttgttatgaaagatgctctgaagatatttgtaattcatgtctttct
gatatacctactctttcatacttacttagtcataaatagcaaataatacattcatagtat
taagaaattgaaagaaagtgcaaaaactgtagttcattagaaaataaagaaattgaagaa
gttccttgtgttgagtataattgtccatatttatatgcaaaaaaatattctaaagataat
cttgactacctcagcaagattatttctaaatatttaaacataatcaacgaatcattttga

DBGET integrated database retrieval system