KEGG   Tetrahymena thermophila: TTHERM_00463650Help
Entry
TTHERM_00463650   CDS       T01020                                 

Definition
(RefSeq) glycosyl hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
tet  Tetrahymena thermophila
Pathway
tet00052  Galactose metabolism
tet00500  Starch and sucrose metabolism
tet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    TTHERM_00463650
   00500 Starch and sucrose metabolism
    TTHERM_00463650
Enzymes [BR:tet01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     TTHERM_00463650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 7843645
NCBI-ProteinID: XP_001018862
TGD: TTHERM_00463650
UniProt: Q23PR8
LinkDB All DBs
AA seq 785 aa AA seqDB search
MIFTKICFIKCLIITQLLKLIQSQQFDSRPHVVAENLLMDYVSLGVIFQKSALQQSLYSQ
NVGNDSVQKNTNLVNIVEDQDKEINQNNLKSNNTRLNLLDLDKLQQNVFYVLKKKTIQDN
KIQLLIQLYQNFDFYLNTYNNFIKCIKLTLYCRDASFIDLVAEDVNDDLRFKYKNQNFEQ
RNEKSFCFNNTNFSIFISDYNEPFQLKILRKNTNTLLFSLDERFVMSDKYIHLKYQASSK
FIFGLGERNYKFKLEFNNSLYTLWNRDVPQDIETADSKGGHNTYGSHPVYLMKDTDYQDE
NNQTDTHFHLIYLQNVNAMDIFLTKQQEIEYRITGGILDFKIIACDSPSNCVQRYNVFLG
KQALMPLWAYGFHQSRWGYQNIDEVKQIIAEYNFIEFPVESIFIDIDYMINYNTFTVNQT
IFPLNNYSIMKDIEKRIVPILDVGIGLENQTLQVRQDALYYNVGVKDLTHKIYIGRVWPG
YTLFPDFQKPITKIFWQNYTFNFMKQNNISAFWLDMNEYANFCHGICEELYQNYRQSYNL
DVELFVEGLAYQPGSKPLENMSLSLVSIHEESGDLEFNFHNINGYLHSQSTYKAVKYEMQ
NPLPFLISRSTIPGSGNYVSHWAGDNNSSYEFMAYSVSSLFNFHIFGIDFTGSDICGFMG
NTTQELCNRWAQLGSLYPFSRNHNHEKLLSQEFFTFDEFGGALFSFRTKYSLLKYYYTLT
LNNTYKIQPAFMNFANDSNLYLDNILETHIMIGQHLISVPVLKQGQNYYEIYFPQGRWQI
LNQNI
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgatttttacaaaaatttgctttataaaatgcttaattataacttagttattaaaattg
atacaaagttagtaatttgatagtagacctcatgtagtagcagaaaatttactcatggat
tatgttagcttaggggtcatattttagaaatctgcgctttagtagagcttatattcttaa
aatgtaggcaatgatagtgtttaaaaaaatactaatttagtcaacatagtagaagattag
gataaagaaattaattaaaataacttaaaaagtaataatactcgtttaaatctattggat
ttggataaattatagtagaatgttttttatgtgttaaagaaaaagactatttaagataat
aaaatataattattaattcagttgtactagaattttgacttctaccttaatacttacaat
aattttatcaaatgtattaaactaactctatactgtagagatgcttccttcattgatttg
gttgcagaagatgtaaatgatgatttaagatttaaatataaaaattaaaattttgagcag
agaaatgaaaaatccttttgctttaataatacaaacttttctatatttattagcgattac
aatgagcctttctaattaaaaatattaagaaaaaatacaaatactttgttattcagctta
gatgaaagatttgtgatgagtgataaatatattcacttgaagtactaagcaagtagtaag
tttatttttgggttaggagaaagaaattacaagtttaaattagaattcaataattcgctt
tacactttgtggaatagagatgtgccctaggatattgaaactgctgattctaaaggaggt
cataacacatatggctctcaccccgtttatttaatgaaagatactgactattaggatgaa
aacaaccagacagatactcattttcatttaatttatctttaaaatgtaaatgctatggat
atatttctaacaaaacaataagaaatcgaatatcgtattacaggaggaattttagatttt
aaaataatagcatgcgattctcctagtaattgtgtgcagagatacaatgtcttcttagga
aaataggctttgatgcctctctgggcatatggatttcaccaatctagatggggatattag
aatatagatgaagtaaaataaataattgcagaatacaatttcatcgaatttcctgtagaa
agtatattcatagacattgattacatgataaattataacacttttacagttaattaaact
atatttcctctaaacaactactctatcatgaaagatattgagaaaaggatagttcctatc
ctagatgtaggaattggattagaaaaccaaacactgcaagtaagataagacgcattatat
tataacgtaggtgtcaaagacctcacccataaaatttatataggaagagtttggcctggc
tacactttatttcctgacttttaaaaacctattacaaaaatattctggtagaattacaca
tttaactttatgaagtaaaataacatatcagcattctggttagacatgaatgaatatgct
aatttctgtcatggaatttgtgaagagttgtaccaaaattacagacaatcatataattta
gatgtagagttatttgtagaaggtttagcttatcagcctggaagtaaaccacttgaaaac
atgtctttaagtttggttagtattcatgaggaaagtggagatttagagtttaattttcat
aatattaatggatatttgcattctcagtctacatacaaggctgtcaaatatgaaatgtaa
aaccctttgcctttcttgatatcaagaagcactattcctggtagtgggaattatgtttct
cattgggctggtgataataattcttcatatgagttcatggcttattccgtgtctagcctt
tttaatttccatatttttggcatagattttactggtagcgatatttgtgggttcatggga
aatactacctaagaattatgcaacagatgggcttaattaggatctttatacccatttagc
aggaatcataatcatgaaaagctgttaagctaggaattctttacttttgatgaatttgga
ggagcactattttcattcagaacaaaatactctctgttaaaatattactacactcttact
ctcaataacacctacaaaatttaaccagcatttatgaattttgctaatgactcaaaccta
tatttagataatattttagaaactcatattatgattggtcagcatctcatctctgtacct
gttttaaaataaggataaaattattatgaaatttattttccttaagggagatggtaaatt
ttaaattaaaatatttga

DBGET integrated database retrieval system