KEGG   Thermococcus eurythermalis: TEU_02825Help
Entry
TEU_02825         CDS       T03421                                 

Definition
(GenBank) glycosyltransferase
Organism
teu  Thermococcus eurythermalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21 Glyco_tranf_2_4 Glyco_tranf_2_2 Chitin_synth_2
Motif
Other DBs
NCBI-ProteinID: AIU69363
UniProt: A0A097QSB1
LinkDB All DBs
Position
521306..522646
Genome map
AA seq 446 aa AA seqDB search
MRPSLKFQSVLYLYILLLAGLSLLIPVPYILEAVLFFLFVMVSSGLVFYTLLIFATQRDY
PARPKPVPRGFFEPTVYVLIPAHNEEAVIEKTARSVLNQDYSNFKVFLINDNSTDRTLEV
MKKIESAWRGKAVVINVPSHRGRSKPRALNYTLEVIEAAFKWPDYIFILDADYLLGPDAL
RTLVGIMESAPNYVIGVQGNVRPRNWNRNFITRFITLERLVGFNVAIEGDMKLNENGKYG
GTVALLRFSHLLRLGKFREDSVTEDTDLWARALIEGYRFWYYHGVTGWEEAVETMKDYIK
QRSRWAQGHLQVMLEYYWPVLRSCSGLTEAFIEHFYMMSYLVPVFWFLSVLLNGYLVLSG
GVPLALARPRLFLVISVLAFLVFWVSVAYSNWLEKRRTGFGVQWWFVGAYPAYFLLFVLA
GVVYTMRGLLRLLAGRLHWEKTRRFT
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgtccctcaagttccaatcagtgctttacctgtacattctcctgctggcgggg
ctctccctgttgattccggttccttacatacttgaggcagtcctgtttttcctgttcgtc
atggtctcgtcgggcctcgtcttctacacgctcctcatctttgccacccaaagggactat
ccggcgaggccgaaaccagttcccaggggtttctttgagccaacggtttacgtcctcatt
cccgcccacaatgaagaggcggtcatagagaaaacggcccgttctgtgcttaaccaggac
tactcaaacttcaaggtctttctgataaacgacaactccaccgaccggacgcttgaggta
atgaagaaaatcgaatcggcctggaggggcaaagcggttgtcatcaacgtcccgtcccac
aggggacggagcaagccgagggccctgaactacacccttgaggtcatagaggccgcgttc
aagtggcctgactacatttttattctcgatgcggactacctcctcgggcctgatgctctg
aggactctcgtgggcatcatggaaagtgcccccaactacgtcattggggtgcagggtaac
gtcaggccgagaaactggaacaggaacttcatcacccgctttataacccttgagaggctc
gtgggctttaacgttgccatagagggggacatgaagctcaatgaaaatggaaagtacggc
ggaacggtcgctcttctccgcttttcgcatctccttcgcctgggcaagttccgtgaggac
tccgttaccgaggacacggacctctgggcgagggcgctgatagagggctaccgcttctgg
tactaccacggtgttactggctgggaagaggccgtcgagacgatgaaggactacatcaaa
cagcgctcccgctgggcgcagggacacctccaggtcatgcttgaatactactggccagtc
ctgaggagttgctctggccttactgaggccttcatagagcacttttacatgatgagctac
cttgtgccggtgttctggttcctctcggttcttctcaacggctacctcgtcctctcgggg
ggcgttcccctggccctcgccaggcccagactctttctcgtgatttcagtcctcgcgttc
cttgtcttctgggtctcggttgcctattcgaactggcttgaaaaacggagaactgggttt
ggagtccagtggtggttcgttggggcttaccccgcttacttccttctcttcgtccttgcg
ggggttgtttacacgatgcgtggcctgctgaggctcctcgccggcaggctccactgggag
aagacgaggcgcttcacttaa

DBGET integrated database retrieval system