KEGG   Thermococcus eurythermalis: TEU_06620Help
Entry
TEU_06620         CDS       T03421                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
teu  Thermococcus eurythermalis
Pathway
teu00030  Pentose phosphate pathway
teu01100  Metabolic pathways
teu01120  Microbial metabolism in diverse environments
teu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:teu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TEU_06620
Enzymes [BR:teu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TEU_06620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AIU70025
UniProt: A0A097QU58
LinkDB All DBs
Position
1199523..1201340
Genome map
AA seq 605 aa AA seqDB search
MYGNWGRFLRVNLSTGEVKVEEYNEELAKKWLGSRGLAIYFLLRDMDPKVDPLSPDNKLI
ITPGPLSGTSAPTGGRYNVVTKSPQTGFITMANSGGYFGAELKFAGWDGIIVEGKADNPV
YIYIKDDNVEIRDASHLWGKVVSETEKTLREEVGSKKVRILSIGPAGENLVKFAAIMNDG
HRAAGRGGVGAVMGSKNLKAIVVEGSKSVPIADRQKFMLTIREKINKLKNDPTAGGGLPK
YGTAVLVNIINENGLYPTRNFQTGVFEHAYEQSGEAMAKKYLIRNQPCYACPIGCGRVNR
LPTVGVTEGPEYESIWALGANLGINDLASIIEANHQCDEFGLDTISTGGTLAAAMELYEK
GYLTDDELGDAPPFRWGNTEVLHYYIEKIAKREGLGDKLAEGSYRFAEMYGHPEFSMSVK
KLELPAYDPRGAEGHGLGYATNNRGGCHIKNYMISPEILGYPYKMDPHDIGDDKIKMLIV
FQDLTAIIDAAGLCVFTTFGLGADDYRDLLNAALGWDFTTEDYLKIGERIWNAERIFNLK
AGLDPARDDSLPKRFLEEPMPEGPNKGHVVRLKEMLPRYYKLRGWTEDGRVPKEKAEELG
IAEFL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaaactggggcaggtttctgcgagtgaacctctccacgggagaggtcaaggtt
gaggagtacaacgaagagctcgccaagaagtggctcgggagcaggggtctggcgatatac
ttccttctgcgtgacatggacccgaaagttgacccgctcagccctgacaacaagctcata
ataacccccggcccgctcagcggaaccagcgcgcccaccggtggcaggtacaacgtcgtc
accaagagcccccagaccggcttcataaccatggccaactccggcggttactttggagcg
gagctcaagttcgccggatgggacggcataatagtcgaaggaaaggccgacaacccggtt
tacatctacatcaaggacgacaacgttgagattagggacgcctcccacctatggggcaaa
gtagtgagcgagaccgagaagaccctcagagaggaggtaggcagtaagaaggtcagaatt
ctgagcataggcccggccggtgagaacctcgtcaagttcgcggctataatgaacgacggc
cacagggcggccggtagaggtggcgtcggtgcagtcatgggaagcaagaacctcaaggct
atagtcgtcgagggaagcaagagcgtcccgatagccgacaggcagaagttcatgctcacc
atcagggagaagataaacaagctcaagaacgaccccaccgccggaggaggccttccgaag
tacggaacagctgtcctcgtcaatatcatcaatgaaaacggcctctacccgaccaggaac
ttccagaccggcgtctttgagcacgcctacgagcagagcggtgaggcgatggccaagaag
tacctcataaggaaccagccgtgctacgcctgtccgataggctgtgggagggtcaacagg
ctcccgaccgttggcgtcactgaggggcctgagtacgagagcatctgggcgcttggtgcc
aacctcggcataaacgacctcgcgagcattatcgaggccaaccaccagtgtgatgagttc
ggtctcgacacaatctcgaccggcggaaccctggccgctgcgatggagctctacgagaag
ggctacctcaccgacgacgagctcggcgacgctccgcccttcaggtggggcaacacagag
gttctccactactacatcgagaagatagccaagagggaaggccttggagacaagctcgct
gaaggaagctaccgcttcgccgagatgtacggccaccccgaattctcaatgagcgtcaag
aagcttgaacttccggcctacgacccgaggggtgccgaggggcacggcctcggttacgcc
accaacaaccgcggtggatgccacattaagaactacatgataagccccgaaatcctcggc
tacccatacaagatggacccgcacgacatcggcgacgacaagatcaagatgctcatagtc
ttccaggacctcactgccatcattgacgccgcgggactctgtgtcttcacgaccttcggc
ctcggtgcggacgactaccgcgacctcctcaacgcggcccttggctgggacttcaccacc
gaggactacctgaagataggcgagcgcatctggaacgccgagaggatattcaacctcaag
gccggcctcgacccggcgagggacgacagcctgcccaagcgcttcctcgaagagccgatg
ccagagggcccgaacaagggccacgtcgtcaggctcaaggagatgctcccgcgctactac
aagctccgcggctggaccgaggacgggagggttccaaaggagaaggcggaagagctcgga
attgccgagttcctttga

DBGET integrated database retrieval system