KEGG   Thermococcus eurythermalis: TEU_08190Help
Entry
TEU_08190         CDS       T03421                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
teu  Thermococcus eurythermalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr DUF2524 Spc7 DUF155 DUF4407 Syntaxin_2 Med26 HIP1_clath_bdg
Motif
Other DBs
NCBI-ProteinID: AIU70310
UniProt: A0A097QV07
LinkDB All DBs
Position
1484927..1486819
Genome map
AA seq 630 aa AA seqDB search
MDKLVAKINWSFNRWKGFDWEAFRRRHESGFEFVRRTGYAHEWWNFYEKFSRDNYYGSII
TRPQKFGRGFVFFISRNPLDGKWYFVGFYSDAVMPPDYVSTGVPMRDLLPEVVVKDIETL
VKSSNWKDRHLAYLSRVLSGEEYRTVFVAPKECSASFLPEAYIEVHPEDIGVGRVEGQWK
ITYKITRSQIERLLTETKRRHEAIGSEEAKEIVRRIDRALAKLRVLGPKGEEKKKRETQI
KTISDVSTVPMSFPEELLESYEPVEFLGEGGFAKVFRARRKDDGTIVAIKIPHIDRKTSA
LFIKEVAAWYNLNHENIVRLYKADILPRPYLEMELVEGAEVNGKLIRNLDEYPKPVDEKT
ALSIVRGIAKGLAHAHSKGIYHLDLKPLNILLKANLTPKITDWGLAKISARSSLSRHYGY
SPLYAAPEQLDEETFGTPDHRTDIYQLGLIFYELLTGKSPYEATSPASLFGKILQAKPMP
PSRVNPALAKYDGIFERLLAKQKEERYQSVDEFIEALDSLEELNNELDELKRTKETLKRS
RSGKEIQRLRREIIEKTAEIAVLRARLNDKAGLLNALEDLKFYTWKNLDDLLNAIAQVEM
LLEEGIPVGNDLIERLTVLLHRIQRENDVF
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
ttggacaaactcgttgccaagataaactggtcttttaaccgctggaagggttttgactgg
gaggcgtttaggagaaggcatgaatccgggtttgaatttgtcagaaggacaggatatgcc
catgaatggtggaatttctacgaaaaattttcgcgggataattattacggttccatcatc
acgaggcctcaaaagttcggcagagggtttgtgtttttcataagcagaaatcccttagat
ggcaaatggtattttgttggattttacagcgacgcggtaatgcctcctgattacgtttcc
acgggggtacccatgagggaccttcttccagaggtcgtcgtaaaagacattgaaacacta
gttaaatcctccaactggaaggatagacacctggcctatttatcgcgggtactttctgga
gaggaatatcgcacagtgtttgttgctccaaaggagtgttctgcctccttcttgcccgaa
gcctatatcgaagtgcaccccgaggacataggcgttggacgggtcgagggtcagtggaag
ataacgtacaaaataacaagaagccaaattgaaaggctattaactgaaacgaagaggaga
cacgaagcaattggcagcgaggaagcaaaagaaatagtgcggagaatagacagggcattg
gcgaagctaagggttcttggcccaaaaggtgaagagaaaaagaagagagaaacccagata
aaaaccatttcagacgtctccactgtgcccatgagctttccagaagaattgctcgagagc
tatgaaccagtcgagtttcttggcgaaggtggcttcgcaaaggtcttcagggccagaaga
aaggacgacggcaccatcgttgccatcaaaataccgcacattgacaggaaaacgagcgca
ctcttcatcaaggaggtcgccgcctggtacaatctcaaccacgagaacatagtcaggctt
tacaaagctgatatcctgcccaggccatacctggagatggagctcgttgagggtgctgaa
gtaaatggaaagctcattagaaatctcgacgagtatccaaagcctgttgatgaaaaaacc
gctttaagtattgttagaggtatcgccaagggtttagcccatgcccactcaaagggaatt
taccaccttgacctcaagcctctgaatattcttctcaaggccaacttgactccgaagata
accgactggggcctggcgaagataagcgctaggagctcgctgagcaggcactacggctac
tcgccgctctatgcggccccagaacagctcgacgaggaaacatttgggactcccgaccac
cggacagacatctaccagcttggcctaatcttctacgagctcctgaccggtaagtccccg
tatgaagcaacgtccccggcttccctcttcgggaaaatcctccaagcaaaaccaatgcct
ccctcaagggttaatccagcccttgccaagtacgacggtattttcgagaggcttctggca
aagcaaaaggaggagcgttaccagagtgtagatgagttcatagaagcactggactccctt
gaagagctgaacaacgaactcgatgagttaaagagaacaaaggaaaccctcaagcggagc
cgctctggaaaggaaatacagaggctccggagagagataatcgaaaaaaccgccgaaata
gcggttctaagggccaggcttaacgataaggcagggttgctgaatgctttggaagacttg
aagttctacacgtggaagaaccttgacgacctgctcaatgccatcgcccaggtggagatg
ctgctggaggaaggaattcctgttggcaatgacctaattgaacggcttacagtcttactg
cataggattcagagagaaaatgatgtattttag

DBGET integrated database retrieval system