KEGG   Thermoanaerobacter sp. X514: Teth514_0610Help
Entry
Teth514_0610      CDS       T00648                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
tex00473  D-Alanine metabolism
tex00550  Peptidoglycan biosynthesis
tex01100  Metabolic pathways
tex01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tex00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Teth514_0610
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Teth514_0610
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Teth514_0610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tex01011]
    Teth514_0610
Enzymes [BR:tex01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Teth514_0610
Peptidoglycan biosynthesis and degradation proteins [BR:tex01011]
 Precursor biosynthesis
  Amino acid ligase
   Teth514_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: ABY91918
UniProt: B0K485
LinkDB All DBs
Position
632897..633976
Genome map
AA seq 359 aa AA seqDB search
MEKKKIAVLFGGQSGEHEVSLMSAKSIINNLDKDKYEIYMVGITKKGEWYLYRGDVGKIE
TGEWEKEGIPAIMGASTKYRGIITFEDGENGFYPIDVVFPVLHGPNGEDGTIQGLLELLD
MPYVGANVLSSALCMDKVFTKRIFKEAGLPTPDFVVVYGKEIEDLEAIKKKIEHLGYPCF
VKPANLGSSVGITKVHNEEELPGALKLAAKYDRKLLIERGIDAREIECSVLGNENPEASI
AGEIVPSNEFYDYNAKYFDGGKSLLLIPAPLPDEKMEEVRKLAIKAYKALDLRGMARVDF
LMDRNTGTLYLNEVNTIPGFTKISMYPKLWESSGKSYSTLLDELINLAVESHNEKCREW
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaagaaaatagctgttttatttggcggacaatcaggagaacatgaagtttct
ttaatgtctgcaaagtctataataaacaaccttgataaagataaatacgagatttacatg
gtaggtattacaaaaaaaggagaatggtatctgtatagaggagatgtggggaaaatagaa
actggagaatgggaaaaagaaggaattcctgcaattatgggagcttctacaaagtataga
ggaataataactttcgaagatggagaaaacggtttttatcctatagacgtggtatttcct
gttttacatggtcctaatggagaagatgggactatacaagggcttttagaactattagac
atgccttatgtaggtgctaatgtgctttcttctgctttatgcatggataaagtttttaca
aaaagaatttttaaggaagcggggttacctacacctgattttgtagtagtgtatggaaaa
gagattgaagacttagaagctataaagaaaaaaattgaacacttaggatatccttgtttt
gtaaaacctgctaatttggggtcgagtgttggcattactaaagtccacaacgaggaagaa
cttcctggggccttgaaattagctgcgaaatatgatagaaaattattaatagaaagagga
atagatgccagagagattgaatgctctgttttgggtaatgaaaatcccgaggcctctatt
gcaggagaaattgttccttctaatgaattctatgattataatgctaaatattttgatggg
ggtaaatctcttctcttaatacctgcaccacttccagatgaaaaaatggaagaggtaaga
aagcttgctataaaggcctacaaagctttggatttgagaggtatggcgagagtagacttt
ttaatggatagaaatacaggtactctttatttaaatgaagttaataccattccggggttt
acaaaaataagcatgtatcccaaattatgggaatcaagtggaaagtcttattcaacatta
ttggatgagcttataaacttagcagtagagagccataatgaaaaatgtagggaatggtga

DBGET integrated database retrieval system