KEGG   Thermoanaerobacter sp. X514: Teth514_1007Help
Entry
Teth514_1007      CDS       T00648                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
tex00340  Histidine metabolism
tex01100  Metabolic pathways
tex01110  Biosynthesis of secondary metabolites
tex01230  Biosynthesis of amino acids
Module
tex_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tex00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Teth514_1007
Enzymes [BR:tex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     Teth514_1007
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Teth514_1007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG SH3_9 SH3_1 DUF3239
Motif
Other DBs
NCBI-ProteinID: ABY92306
UniProt: B0K630
LinkDB All DBs
Position
1036820..1037479
Genome map
AA seq 219 aa AA seqDB search
MIDIEELKFDEKGLIPAIVQDYNTKQVLMLAYMNEESLKLSLEKGETYFFSRSRNEIWHK
GETSGNTQKIKNIFYDCDEDALLIEVEPKGPACHTGNVSCFYRSFLGEVENYDMEILKKL
YERVKDRKTNPAEGSYTNYLFEKGIDKILKKIGEETTEVVIASKNDSKEEIVYEVSDLLY
HLIVLLVDKGIKLEDVYGELGRRYYKPKEFKEEHKERKK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgattgatatagaggaattaaagtttgatgaaaaaggacttattcctgcgattgtgcaa
gactacaacacaaaacaagtattaatgttggcttatatgaatgaggaaagtttaaaatta
agcttggaaaagggagagacatatttttttagcagaagcaggaatgaaatttggcataaa
ggggaaacttcaggtaatacccaaaagataaagaacatattttatgactgtgatgaggat
gctttgctaattgaggtggagccaaaagggccggcatgtcatacagggaatgtaagctgt
ttttataggagctttttaggtgaagttgaaaattatgacatggaaatacttaaaaagcta
tatgaacgggtaaaagatagaaagacaaacccggcagaagggtcttatactaattatttg
tttgaaaaaggcatagataagattttaaagaaaattggcgaagaaactacggaggtagtg
atagcttccaaaaatgactccaaagaagagatagtgtatgaggtttcagatttactttat
catttaatagttttgttagttgacaaaggtataaagctcgaggatgtatacggtgagctt
ggcagaaggtattataagccaaaggaatttaaagaagaacataaagagagaaagaaatag

DBGET integrated database retrieval system