KEGG   Thermoanaerobacter sp. X514: Teth514_1749Help
Entry
Teth514_1749      CDS       T00648                                 

Definition
(GenBank) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tex  Thermoanaerobacter sp. X514
Brite
KEGG Orthology (KO) [BR:tex00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tex01001]
    Teth514_1749
Enzymes [BR:tex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Teth514_1749
Protein kinases [BR:tex01001]
 Serine/threonine kinases: Other
  Bacterial family
   Teth514_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH ETRAMP Pkinase_fungal ABC1 RIO1 Kinase-like FTA2 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ABY93035
UniProt: B0K1Y7
LinkDB All DBs
Position
complement(1752030..1753907)
Genome map
AA seq 625 aa AA seqDB search
MIGRILGNRYEILEKIGAGGMAKVYKAKCHLLNRIVAIKILRPEFAADEDFVKKFRRESQ
AAASLSHPNIVSIYDVGQEGDIYYIVMEYVKGRTLKKLISENGGPLEVGRAIEIARQVCK
ALDHAHKNRIIHRDIKPQNILVTDDDVVKVTDFGIARAANGSTITYTGDVVGTAYYFSPE
QARGGIVDERTDIYSLGIVLYEMLTGKVPFEGDSPISVALKHIQEDIIPPSKLNDKVPKE
LDQIVLKATQKDVNLRYQTAADFLKDLDVFLRNPKELNFKEEENTKTRVIPSKDVEELKR
AAQRKEKEKKRRNVIKRIATVLLILLLLASLSYGTIYVLNNFFKVSDVVVPNVVGLSLNQ
ASKILSDHNLKMEISEERYSDKPENTILSQDPPQGSVVKTGTTVYVVISKGTQVVVVPNV
INKDYLEAKNILENMGLKANIIEQYNDQFPRGYVFDQNPRQGVQVEYNTVIDLYVSKGQQ
PAIMPNVVNMTLEEATTALENAGLKLGKVIYKETTDVPENVVLEQSVPPNSEVQKGSPID
LIVSKMPQDSLQQRTKNVIIELPNKPGTMKVDVYVIQNEQKNLVYSDEHTYQESPLTVPV
TAYKGKATIEVDIDGEVYSTVEARF
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgattggacgtatattaggtaaccgatatgaaatattagagaaaattggcgcaggggga
atggctaaggtttacaaagcaaagtgtcatctccttaacagaatagtggcaatcaaaatt
ttgaggcctgaatttgcagcagatgaggattttgtgaaaaaatttagaagagagtctcag
gcagcggcaagtctttctcatcctaatatagtgagtatatacgatgttgggcaagaagga
gatatttactacattgtgatggaatatgtaaagggacgtactttaaaaaagcttataagt
gaaaatggaggaccgttagaagtaggtagagcaatagaaatagcacgacaagtttgtaaa
gccctggatcacgcccataaaaatcgaataattcacagagatataaaacctcaaaatatt
cttgttactgacgacgatgtggtgaaagttactgattttggaattgcacgagctgctaat
ggttctactataacttacaccggagatgtggtaggaactgcttattatttttcgcctgaa
caggcaaggggtggaatagtagatgaaaggacggatatttactctttaggaattgtcctt
tatgaaatgttaacaggaaaagtgccttttgagggagacagtcctatttctgtcgcttta
aaacacattcaagaagatataattcctccttcaaagctaaatgacaaagtaccaaaagaa
ttagatcaaatagttttaaaagctactcaaaaagatgtaaatctaaggtatcaaactgca
gcagattttcttaaggacctagatgtttttttgcgaaaccctaaagaactaaacttcaaa
gaagaggaaaacacaaaaacacgggtgattccttctaaagatgtagaagagttaaagaga
gcggcacaaagaaaggagaaagaaaagaaaaggcgaaacgtcataaagagaatagcaact
gttttattaattctcttgctactggcttctttgtcttatggtaccatatacgtcctcaat
aacttttttaaagtgagcgatgttgtggttccaaatgttgttggtttgtccttaaaccaa
gcaagtaaaattctatcagaccataatttaaagatggagataagtgaagagcggtatagc
gataaacctgaaaatactattttatctcaagaccctccacaagggagtgtagtaaaaact
ggaactacagtttatgtagtgattagtaaaggtacgcaagttgttgtggtgcctaatgtt
ataaacaaagattatttagaggctaaaaatattcttgagaatatgggcctcaaagcaaat
attatagaacaatacaatgaccagtttcctagaggatatgtttttgaccaaaatccaaga
caaggagtacaggtagaatataacacagtgattgatctgtatgttagcaaaggtcaacag
ccggcaataatgcccaacgtagttaatatgacattggaggaagcaacaactgccttagaa
aatgctggtttaaaattaggtaaagtcatttataaagagacaactgatgtgccagaaaat
gtagttttagagcaaagtgttcctccaaacagtgaggttcaaaagggaagtccgatagat
ttaattgtcagcaagatgcctcaagattctttacaacaacgaactaaaaatgttattatt
gaattgcccaacaaaccgggtactatgaaagtggatgtatatgtaatacaaaatgagcaa
aagaatttagtatattctgatgaacacacttatcaagaaagcccccttactgttcctgta
acggcatataaaggtaaagctacaattgaggtggatatagatggagaagtgtatagtaca
gtggaggcgagattttaa

DBGET integrated database retrieval system