KEGG   Thermoanaerobacter sp. X514: Teth514_1992Help
Entry
Teth514_1992      CDS       T00648                                 

Definition
(GenBank) phosphate ABC transporter, ATPase subunit
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
tex02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tex00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Teth514_1992
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tex02000]
    Teth514_1992
Enzymes [BR:tex01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Teth514_1992
Transporters [BR:tex02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Teth514_1992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N Rad17 AAA_22 RsgA_GTPase AAA_15 AAA_16 AAA_29 AAA_18 NB-ARC AAA AAA_33 AAA_24 PRK IstB_IS21 RNA_helicase ATPase_2 G-alpha Septin AAA_13 DUF87 AAA_30 AAA_5 AAA_23 AAA_28 IIGP MMR_HSR1 TsaE AAA_19 AAA_25 AAA_7 Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: ABY93264
UniProt: B0K3F3
LinkDB All DBs
Position
complement(2002236..2002985)
Genome map
AA seq 249 aa AA seqDB search
MKKIQVKDLDLFYGDVQALKKITLDVEANSVLALIGPSGCGKSTFIRTLNRMNDLIEGVK
ISGTVLLDGQDVYKEVDVIELRKRVGMVFQKPNPFPMTVYDNVAYGPRIHGIKDKKKLNE
IVEKSLKAAALWDEVKDRLDKSALSLSGGQQQRLCIARTLAVEPEVILMDEPTSALDPIS
TMKIEELINELKNKYTIIIVTHNMQQAGRVSDYTAFFLNGELIESGPTDRVFYNPKDKRT
EDYITGRFG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatacaggtcaaagatttagacttgttttacggagatgtccaagccctcaaa
aaaataactttggatgtagaagcgaatagcgttttggcacttataggtccctctggttgt
ggtaaatctacctttattcgtactttgaataggatgaacgatcttattgagggagttaaa
ataagtggtactgttttacttgatggtcaagatgtatataaagaagtggatgttattgaa
cttagaaagagagtaggaatggtttttcaaaaacctaatccttttcctatgacggtttac
gacaatgtagcttatggcccaagaattcatggtataaaagacaaaaaaaagttaaatgaa
attgttgaaaaaagtttgaaagctgcagctttatgggatgaagtaaaagataggctcgac
aaatcagctctcagtttgtctggtggccaacagcaaaggctttgtattgctaggacattg
gcagtagaaccagaggtaattttgatggacgagcctacttcagccttagatcctatttct
actatgaaaattgaggaattaattaatgagttgaaaaataaatatacaataataatagta
actcataatatgcaacaagcaggaagagtgtcagattacacggcctttttcttaaatggt
gaattaattgaaagtggaccaacagacagggttttttataatcctaaagataagaggacg
gaagactacattactggaagattcggttaa

DBGET integrated database retrieval system