KEGG   Tessaracoccus sp. T2.5-30: BKM78_01450Help
Entry
BKM78_01450       CDS       T04747                                 

Gene name
kgd
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
tez  Tessaracoccus sp. T2.5-30
Pathway
tez00020  Citrate cycle (TCA cycle)
tez00310  Lysine degradation
tez00380  Tryptophan metabolism
tez01100  Metabolic pathways
tez01110  Biosynthesis of secondary metabolites
tez01120  Microbial metabolism in diverse environments
tez01130  Biosynthesis of antibiotics
tez01200  Carbon metabolism
Module
tez_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tez_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tez00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKM78_01450 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    BKM78_01450 (kgd)
   00380 Tryptophan metabolism
    BKM78_01450 (kgd)
Enzymes [BR:tez01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BKM78_01450 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AQX14746
LinkDB All DBs
Position
299567..303349
Genome map
AA seq 1260 aa AA seqDB search
MSAPDSLDSFGANAWLIDEMREAYQADPSSVDPEWRKLFETEGAPAQPTAAPPAPQAAEQ
PSEAQPAVTPAPPQQSAKPVEAAKGDGEPKDQPAADGEAAPARPAQKSMVERRPKGGERP
ANPGSGSTLSANAPNPALRPEPTAAQPKYTVLRGAPMRTAKNMESSLTVPTATSVRSVPM
KLVIDQRTVINNFLRTSKGGKVSFTHLIGYAMVKALAAMPDMNNAYDVVDGKPTLIENPS
INLGIAIDIRKGDTRQLLVPNIKGCENLNFFQFWSAYEQVVKKTRDGDLQVSDFAGTTAS
LTNPGGIGTNHSVPRLMNGQGVILGVGNIDYPAEFQGMSPSKLTELGVSKVTTLTSTYDH
RVIQGATSGEFLKKLHGLLLGEDRFYDEIFEALRIPYEPLRWSPDISAHRDSQVSKTARV
LELVNAYRTFGHLVADTDPLEYRQRAHEDLRLEAHGLSIWDLDREFAVGTFGGKERVYLP
LRDIIGILQDSYTRTIGVEYMHIADPRQREWFQQRMERPHTPLTHEEHMHALDKLNEAEV
FETFLQTKFVGQKRFSLEGGESLIVLLDEIAQRAANDSLDEVCIGMPHRGRLNVLANVVG
KKYAQIFKEFDGQVDRTGTGDVKYHLGAEGTFVAANGATIKASVAANPSHLEAVNPVLQG
IARAKQDTLAADDYPVLPLTLHGDASFSGQGVVFETLQMSQLRGYKTGGTIHVVVNNQVG
FTTAPTESRSSTYCTDVAKSISAPVLHVNGDDPDACIRAARVAFDYRQRYHKDVVIDLIC
YRRRGHNEGDDPSFTQPNMYDLIEQKRSTRRLYTESLIGRGDISMADAEDVMNRFRARLE
NVFREVRETTEADDDYRKVPYYPTKPDARLTEITPEMLRTIAEVHTQFPDGFTVHPKVMP
QLERRAHAILEGPIDWATAEMIAIGSLLMERRPVRLAGQDSRRGTFSQRFAAIVDRVTNE
AWVPLKHLTEDQGTFDVFDSLLSEYAALGFEYGYSVARPDALVMWEAQFGDFVNGAQIIS
DEFVAAGNAKWTQKSGVVLLLPHGYEGQGPDHSSARIERWLQLCAENALAVCQPSTPASY
FHLLRQHAYVNYHRPVVIATPKSMLRNKLATSHPEDFTSGAWHPVLDDPTIDDPSKVKRL
ILCSGKVRWDLVARREQLGHDGSIAIVALERLYPLPSEELARALQRYAHVDDVRFVQDEP
ENQGAWPFLSVHLPGDVKRHLPDYDLTMTLVAREWSSAPSVGSLKVHKGQEEDLLTAALG
NT seq 3783 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcacctgactcactggactctttcggggcgaatgcatggctgatcgacgagatg
cgggaggcctaccaggccgatcccagctccgtcgatccggaatggcgcaagctgttcgag
actgagggggctcccgcgcagcccaccgccgcgccacccgcccctcaggcggccgagcag
ccgtccgaggcacagcccgccgtgacccccgcaccgccgcagcagagcgccaagcccgtc
gaggcggcgaagggcgatggggagcccaaggaccagcccgccgccgacggcgaggccgca
ccggcccggcccgcgcagaagtccatggtggagcggcggcccaagggcggcgagcgcccg
gccaaccccggctccgggtcgacgctgtcggccaacgcccccaaccccgcgctgcggccc
gagcccaccgccgcgcagccgaagtacacggtcctgcgcggcgccccgatgcgcacggcc
aagaacatggagtcgtcgctgacggtcccgacggccacctccgtccgctccgtccccatg
aagctcgtcatcgaccagcgcacggtcatcaacaacttcctgcgcacctccaagggcggg
aaggtctccttcacgcacctgatcggctacgcgatggtcaaggcgctggcggccatgccg
gatatgaacaacgcctacgacgtcgtcgacggcaagcccaccctcatcgagaacccctcc
atcaacctcggcatcgccatcgacatccgcaagggcgacacccgacagctgctggtgccc
aacatcaagggctgcgagaacctcaacttcttccagttctggtccgcctacgagcaggtg
gtcaagaagacccgcgacggcgacctgcaggtcagcgacttcgcgggcacgacggcgtcg
ctcaccaaccccggcggcatcggcaccaaccactccgtgcctcgcctcatgaacgggcag
ggcgtcatcctcggcgtcggcaacatcgactatccggccgagttccagggcatgagcccg
tcgaagctcaccgagctgggcgtgtccaaggtcacgaccctcaccagcacgtacgaccac
cgcgtcatccagggcgccacctccggcgagttcctcaagaaactccatggcctgctcctc
ggcgaggaccggttctacgacgagatcttcgaggctctgcgcatcccctacgagcccctg
cgctggtcaccggacatctcggcgcaccgtgactcgcaggtgagcaagacggcccgcgtg
ctggagctggtcaacgcgtaccgcacgttcggccacctcgtcgcggacaccgatccgctc
gagtaccggcagcgggcgcacgaggacctgcgcctcgaggcgcacggcctgtcgatctgg
gacctggaccgcgagttcgcggtcgggaccttcggcggcaaggagcgcgtctacctgccg
ctgcgcgacatcatcggcatcctgcaggactcctacacccgcaccatcggcgtcgagtac
atgcacatcgccgacccgcgtcagcgcgagtggttccagcagcggatggagcggccgcac
acgccgctgacgcacgaggaacacatgcacgcgctggacaagctcaacgaggccgaggtc
ttcgagacgttcctgcagacgaagttcgtgggtcagaagcgcttctcgctggagggcggc
gagtcgctgatcgtgctgctggacgagatcgcccagcgggccgcgaacgactccctcgac
gaggtgtgcatcggcatgccgcaccgcggccgcctcaacgtgctcgccaacgtcgtcggg
aagaagtacgcccagatcttcaaggagttcgacggccaggtcgaccgcaccggcaccggc
gacgtcaagtaccacctcggcgcggagggcaccttcgtcgcggccaacggcgccaccatc
aaggcgtcggtcgcggcgaacccgtcgcacctcgaggcggtcaacccggtgctccagggc
atcgcccgcgccaagcaggacacgctggcggccgacgactacccggtcctgccgctgacg
ctgcacggcgacgcgtcgttctcgggccagggcgtggtgttcgagaccctgcagatgagt
cagctgcgcggatacaagaccggtggcaccatccacgtggtcgtcaacaaccaggtgggg
ttcacgacggcgccgacggagtcgcgcagctcgacgtactgcacggacgtcgccaagtcg
atctccgcacccgtcctgcacgtcaacggcgacgacccggacgcctgcatccgggccgcc
cgcgtcgcgttcgactaccggcagcgctaccacaaggacgtcgtcatcgacctcatctgc
taccgccgccgcggccacaacgagggcgacgacccgagcttcacgcagccgaacatgtac
gacctcatcgagcagaagcgctcgacgcggcgcctctacaccgagtccctcatcggccgc
ggcgacatctccatggccgacgccgaggacgtcatgaaccggttccgcgcccgcctcgag
aacgtgttccgcgaggtgcgcgagaccaccgaggccgacgacgactaccgcaaggtgccc
tactacccgacgaagcccgacgcccggctcaccgagatcaccccggagatgctcaggacg
atcgcggaggtgcacacgcagttccccgacgggttcacggtgcacccgaaggtcatgccg
cagctcgagcgccgcgcgcacgcgatcctcgagggaccgatcgactgggcgacggccgag
atgatcgccatcggctcgctgctcatggagcgccggcccgtgcggttggccggccaggac
tcgcggcgcggcacgttctcgcagcgcttcgccgccatcgtggaccgggtcaccaacgag
gcctgggtgccgctcaagcacctcaccgaggaccagggcacgttcgacgtgttcgactcg
ctgctcagcgagtacgccgcgctcggcttcgagtacgggtactcggtggcacgcccggac
gcgctggtgatgtgggaggcccagttcggcgacttcgtcaacggcgcccagatcatctcc
gacgagttcgtcgccgccggcaacgcgaagtggacccagaagtccggtgtggtgctgctg
ctccctcacggctacgagggtcagggcccggaccacagctcggcgcgcatcgagcgctgg
ctgcagctgtgcgcggagaacgcgctggccgtgtgccagccgtcgacaccggccagctac
ttccacctgctgcgccagcacgcctacgtcaactaccaccgccccgtggtgatcgcgacg
cccaagtcgatgctgcgcaacaagctggccacgtcccatccggaggacttcacctccggc
gcctggcacccggtgctggacgacccgaccatcgacgacccgtcgaaggtcaagcgcctc
atcctctgctccgggaaggtgcgctgggacctcgtcgcccgccgagagcagctcggccac
gacggcagcatcgcgatcgtcgcgctcgagcggctgtacccgctgcccagcgaggagctc
gcgcgggcgctgcagcgatacgcgcacgtcgacgacgtgcgattcgtgcaggacgagccg
gagaaccagggggcctggcccttcctgtccgtgcacctgcccggcgacgtcaagcgccac
ctgccggactacgacctcaccatgacactggtggcccgcgagtggtcgtcggcgccgtcg
gtgggctcgctcaaggttcacaagggccaggaggaggacctcctcaccgcggcgctaggc
tga

DBGET integrated database retrieval system