KEGG   Tessaracoccus sp. T2.5-30: BKM78_06865Help
Entry
BKM78_06865       CDS       T04747                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
tez  Tessaracoccus sp. T2.5-30
Pathway
tez00040  Pentose and glucuronate interconversions
tez00051  Fructose and mannose metabolism
tez01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BKM78_06865
   00051 Fructose and mannose metabolism
    BKM78_06865
Enzymes [BR:tez01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BKM78_06865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AQX15663
LinkDB All DBs
Position
complement(1478278..1479267)
Genome map
AA seq 329 aa AA seqDB search
MTAPEFGAGLWNFATYVDRYAIDGYGQPRGTLEQIDLAAEVGDITWVDLNFPFSPGVSLD
DVKAKLAQHGIKAIGLTPDIYLREHCKGAFTNPDPAKRASAMAIMNDAANAVRELGAKYV
KIWPGQDGFDYPFQVDYRELNRLAVEGMRELASGHPDLKFVIEYKPREPRTHMFWSSAPK
TILGIQQMGVDNVGVLLDFGHAMFGGEPPAEAAQMLIDHGLLWGMDVNDNYRGWDDDMMV
GSIHMVEIFEFFHVLKVNNWEGVWNLDQFPFREDAVENAKLSIRFLKAVHRALETLDEEG
LAAAQAKQDALGAQRIIQEALLKSMAVDL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacggcacccgagttcggagctgggctctggaatttcgccacctacgtcgaccgctac
gccatcgacggctacggccagccgcgcggaacgctggagcagatcgacctcgccgctgag
gtcggtgacatcacctgggtcgacctgaacttcccgttctcccccggggtatccctcgac
gacgtcaaggccaagctggcccagcacgggatcaaggccatcggcctcacgcccgacatt
tacctgcgcgagcactgcaagggggccttcaccaacccggatcccgccaagcgggcctca
gccatggcgatcatgaacgacgccgccaacgcagtgcgcgaactcggcgccaagtacgtc
aagatctggcccggccaggacggcttcgactacccgttccaggtcgactaccgcgagctc
aaccgcctggcggtcgagggcatgcgcgagctggcctcggggcacccggacctgaagttc
gtcatcgaatacaagccgcgtgagccccgcacccacatgttctggagctccgcgccgaag
acgatcctcggcatccagcagatgggcgtggacaacgtcggcgtcctgctggacttcggc
cacgcgatgttcggcggcgagccgccggccgaggcggcccagatgctcatcgaccacggg
ctcctgtggggcatggacgtcaacgacaactaccgcggctgggacgacgacatgatggtc
ggctccatccacatggtggagatcttcgagttcttccacgtcctcaaggtcaacaactgg
gagggcgtctggaacctcgatcagttccccttccgcgaggacgccgtcgagaacgccaag
ctgtcgatccggttcctcaaggccgtccaccgcgccctcgagacgctggacgaggagggg
ctcgcggccgctcaggccaagcaggacgcgctcggcgcgcagcggatcatccaggaggcg
ctgctgaagtccatggcggtcgatctgtga

DBGET integrated database retrieval system