KEGG   Tessaracoccus sp. T2.5-30: BKM78_08110Help
Entry
BKM78_08110       CDS       T04747                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tez  Tessaracoccus sp. T2.5-30
Pathway
tez00564  Glycerophospholipid metabolism
tez01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tez00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BKM78_08110
Enzymes [BR:tez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BKM78_08110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 3HCDH_N Pyr_redox HI0933_like GIDA
Motif
Other DBs
NCBI-ProteinID: AQX15885
LinkDB All DBs
Position
1766091..1767803
Genome map
AA seq 570 aa AA seqDB search
MTALTQAQRATSLRAMGSQHFDVLVIGGGVTGAGIALDAASRGLRTAVVEAQDWASGTSS
RSSRLVHGGLRYLYNLDFKLVAEALTERGRLLTTIAPHLVEAQPFLWPLKQRVIERAYSA
VGVGLYDALAVAGAGFRKTVPLQKHLSKDGARGRFPDIKPDALIGAIEFYDARVDDARLV
VTLIRTAVKYGAEAASRVKVTGVRKNDAGRVDGVEAVDLESGDTLTISATRVINATGVWT
EQTQKLAGSSGGLKVLASKGIHIVLPRERIKASAGMFLRTEKSVLFIIPWQHYWVIGTTD
TAWHEQLEHPVPTSADIDYILAHANEVLAEPLTRDDIIGTYAGLRPLLQPAVLDESKSTK
VSREHTVTEVAPGMVSIAGGKLTTYRVMAEDAVDFALGSAEAKAKPSVTADLPLLGAEGF
AAARNQADRLGARYGLDADRMKHLLSRYGSEVESLLATIDADPTLGRPLAAAPQFLRAEV
AWACTVEGALHLEDILVARVRLNSESRDRGGAAVDEVGEIAAEALGWDAARLEREKANYR
ARIAAEIAAEEQPTDAAASAERMKADDIVG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcactcacccaggcccagcgtgccacgtcgcttcgtgcgatggggtcacaacac
ttcgacgttctcgtcatcggtggcggggtgaccggcgcggggatcgcgctggacgccgcc
tcccgcggactgcggaccgccgtcgtcgaggcccaggactgggcgtccggcacgtcgtcg
cggtcgtcgcgtctcgtgcacggcggcttgcgctacctctacaacctcgacttcaagctg
gtcgccgaggcgctgaccgagcgcggacggctcctgaccaccatcgccccgcacctcgtc
gaggcgcagccgttcctgtggccgctcaagcagcgggtgatcgagcgcgcgtactcggcg
gtcggcgtcgggctctatgacgcgctcgcggtcgcgggcgccggcttccgcaagacggtc
ccgctgcagaagcacctctccaaggacggcgcgcgcgggcgcttcccggacatcaagccc
gacgcgctgatcggcgccatcgagttctacgacgcccgggtcgacgacgcccgcctcgtc
gtcacgctcatccgcaccgccgtcaagtacggcgccgaggccgccagccgggtcaaggtc
accggtgtccggaagaacgacgccgggcgcgtggacggcgtcgaggccgtggacctggag
agcggcgacacgctcaccatctcggccacgcgggtgatcaacgccaccggcgtttggacc
gagcagacccagaagctcgccggcagcagcggcggcctcaaggtcctggccagcaagggc
atccacatcgtgctgccccgggagcgcatcaaggccagcgcgggcatgttcctgcgcacc
gagaagtcggtgctgttcatcatcccctggcagcactactgggtcatcgggaccaccgac
accgcctggcacgagcagctcgagcatccggtgccgaccagcgccgacatcgactacatc
ctcgcccacgccaacgaggtgctcgccgagcccctcacccgcgacgacatcatcggcacg
tacgccgggctgcggccgctgctgcagccggcggtgctggacgagtcgaagtcgacgaag
gtgtcgcgggaacacaccgtcacggaggtcgcacccggcatggtctcgatcgccggcggc
aagctgacgacctatcgggtgatggccgaggacgccgtcgacttcgcgctgggctccgcc
gaggcgaaggcgaagccgtcggtcacggccgacctcccgctgctcggcgcggagggcttc
gcggcggcccgcaaccaggccgaccggctcggtgcccgctacggcctcgacgccgaccgg
atgaagcatctgctgtcgcgctacggatccgaggtggaatcgctactggcgaccatcgac
gccgatccgaccctgggccgtccgctggccgctgcaccgcagttcctgcgcgccgaggtc
gcctgggcgtgcaccgtcgaaggggccctgcacctcgaggacatcctcgtcgcgcgcgtg
cggctcaactcggagtcgcgggaccggggcggcgccgccgtcgacgaggtcggcgagatc
gcggccgaggccctgggctgggacgcggcgcggctcgagcgggagaaggcgaactaccgg
gcccgcatcgctgcggagatcgcggcggaagagcagccgaccgacgccgcggcgtcggcg
gaacggatgaaggccgacgacatcgtcggctga

DBGET integrated database retrieval system