KEGG   Tessaracoccus sp. T2.5-30: BKM78_10005Help
Entry
BKM78_10005       CDS       T04747                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
tez  Tessaracoccus sp. T2.5-30
Pathway
tez00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:tez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BKM78_10005
Enzymes [BR:tez01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BKM78_10005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_2_C DUF4350 Cellulase Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: AQX16208
LinkDB All DBs
Position
complement(2189976..2192000)
Genome map
AA seq 674 aa AA seqDB search
MTTPWPAIDGIAYGGDYNPDQWPRAVWDEDVALMRRAGVNLVSVGIFSWGKLEPSPGRFD
FAWLDEILDLLHGNGIAVDLGTPTAAPPAWFFADHPDSRVITRDGTVMGFGSRGMVSHSS
PAYRDAIVRVAGALAERYADHPAVVLWHIHNEYGTPVSEDYSRHSVTAWRSWLRARYGTL
DQLNELWGTAVWGQTYHSWEHIGAPAAAPSVVNPTMRLDWARFTDHQLRECFSLERDAIR
RHATQPVTTNFMANQHWGTDLWEWAKLVDVVADDHYLTAADREAHIGLAIAADLSRSVAG
GKPWMLMEHSTSAVNWQPRNVAKRPGEMARNSLTHVARGADAVMFFQWRAARYGQEKFHS
AMLPHAGVDSRVFREVVDLGATLQRIDAVRGSRVEAEVAVLCDFESFWAQDLEWRPSEDL
DYRQQLRAYYERLWRDNVTVDFALPSHDLSRYRLVVIPSQYLLRADDAANLTRYVEAGGT
LLVSYFSAVVDEYDAVHRGGFLAPLEPALGVWVEEFLPLREGDSMTVVTGDGASLAADMW
AEDLVVTGADVVATYEDGPAAGKPAITRHRHGAGHAWYVSTRLDADALRQVMRRVYDDAG
LAPAALPDGVEVVARRGAGETFTVAVNHTDQAVDLPFPGTDLVTGHDTGGSLRLAGGAVA
VVRADDPDRSIPEH
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaccccctggccagccatcgacggcatcgcctacggcggcgactacaaccccgac
cagtggccgcgcgccgtgtgggatgaggacgtcgccctgatgcgccgcgcgggcgtgaac
ctggtgagtgtcggcatcttctcgtggggaaagctcgagccctcccccggccggttcgac
ttcgcctggctcgacgagatcctcgacctcctgcacggcaacggcatcgccgtcgacctc
ggcacgcccaccgccgctccgccggcctggttcttcgcggaccacccggactcccgcgtc
atcacccgcgacggcacggtcatgggcttcgggtcccgcggcatggtgtcacactcctcg
cccgcctatcgcgacgccatcgtccgcgtggccggggcgctggccgagcgctacgccgac
caccccgccgtcgtgctctggcacatccacaacgagtacggcaccccggtgagcgaggac
tactcgcgccactccgtcaccgcgtggcgctcctggctccgcgcccgctacggcaccctc
gaccagctcaacgagctgtggggcaccgcagtgtgggggcagacgtaccactcctgggag
cacatcggcgcccccgccgccgccccgtcggtcgtcaaccccacgatgcggctcgactgg
gcgaggttcacggaccaccagctacgcgagtgcttctcgctggagcgcgacgcgatccgc
cgccacgccacccagccggtcaccaccaacttcatggccaaccagcactggggcaccgac
ctgtgggagtgggcgaagctcgtcgacgtcgtggcggacgaccactacctcaccgcggcc
gaccgggaggcccacatcgggctggccatcgccgcggacctcagccgctccgtcgcaggc
ggcaagccctggatgctgatggagcactccacgtccgcggtgaactggcagccgcgtaac
gtcgcgaagcgccccggcgagatggcgcgcaactcgctgacccacgtcgcgcgcggcgcc
gacgccgtcatgttcttccagtggcgggccgcccgctacggccaggagaagttccactcg
gcgatgctcccgcacgccggcgtcgacagccgcgtcttccgcgaggtcgtggatctgggc
gcgacgctccagcgcatcgacgccgtccgcgggtcgcgcgtcgaggccgaggtggcggtg
ctgtgcgacttcgagtccttctgggctcaggacctggaatggcgtccctccgaggacctc
gactaccgccagcaactgcgcgcctactacgagcggctctggcgcgacaacgtgaccgtc
gacttcgccctcccctcgcacgacctcagccggtaccgcctggtcgtcatcccgtcgcag
tacctgctgcgcgccgacgacgccgcgaacctcacgcgctatgtcgaggccgggggcacg
ctgctggtgtcctacttctcggccgtcgtcgacgagtacgacgccgtccaccgtggcggg
ttcttggctcccctcgaaccggcgttgggcgtgtgggtcgaggagttcctgccgctgcgc
gaaggcgactccatgacggtggtcaccggcgacggcgcatcgctcgccgcggacatgtgg
gcggaggacctcgtcgtgaccggggccgacgtcgtcgccacgtacgaagacggacccgcc
gccggcaagccggccatcacccggcaccggcacggcgccggtcacgcctggtacgtctcg
acccgactggacgccgacgccctccgccaggtgatgcgacgcgtctacgacgacgccggc
ctggcaccggcggccctccccgacggcgtcgaggtcgtcgccaggcgcggcgccggtgag
acgttcaccgtcgccgtcaaccacaccgaccaggccgtggacctcccgttccccggcacc
gatctggtcaccggccacgacaccggcggatccctccgcctggccggcggcgccgtcgcc
gtcgtccgtgccgatgaccccgaccgctccatcccggagcactga

DBGET integrated database retrieval system