KEGG   Tessaracoccus sp. T2.5-30: BKM78_10350Help
Entry
BKM78_10350       CDS       T04747                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
tez  Tessaracoccus sp. T2.5-30
Pathway
tez03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tez00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BKM78_10350
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tez03400]
    BKM78_10350
Enzymes [BR:tez01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BKM78_10350
DNA repair and recombination proteins [BR:tez03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BKM78_10350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AQX16269
LinkDB All DBs
Position
complement(2260914..2261900)
Genome map
AA seq 328 aa AA seqDB search
MRPMLATPSRTPGVPPSGPGWVHEVKWDGIRALAETRADGIRLLNRTEGDITVAYPEVAA
GAAGLPDGLVVDGEVVALGPDGTPSFHAIMPRMHVRDAARAARWAAERPVTFVVFDVLRV
GGQDVTARPWTERRALLERLDLDRPAWRRSETFDDGDALARFTREAGLEGVMSKRRDSPY
LPGHRSEAWVKTPHRSELVAVIGGWLPESGNLHALGALWVGQPADEATFDSRPVLYPMGR
VGSGLGRGERDTLLAVLRDTERPTPPFDPAPTDPMARRARWVEPMLCVQVRYLEVTPDGA
LRQPVLRALRPDVSPVDAAAAALLPTAP
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccatgctcgccacgccgtcgcggaccccgggagtcccgccgtcggggccaggc
tgggtgcacgaggtcaagtgggacggcatccgcgccctcgccgagacccgggccgacggc
atccggctcctcaaccggaccgagggcgacatcacggtggcctacccggaggtcgccgcc
ggggcggcggggctgcccgacgggctcgtggtggacggtgaggtggtggccctgggaccc
gacggcacgccgtcgttccacgcgatcatgccgcgcatgcacgtgcgcgacgcggcgcgg
gccgcccgctgggccgccgagcgtcccgtcacgttcgtcgtgttcgacgtgctgcgcgtc
ggcgggcaggacgtgaccgcccggccgtggaccgaacgccgggcgctgttggagcggctc
gacctcgaccggccggcgtggcgccgctccgagaccttcgacgacggcgacgccctcgcc
cgcttcacccgcgaagccggcctggagggcgtgatgagcaagcggcgtgactcgccctac
ctgcccggccaccgcagcgaggcctgggtgaagaccccccaccgctcggagctggtcgcc
gtcatcggcggctggctgcccgagtcggggaacctgcacgcgctcggcgcgctgtgggtg
ggccagcctgccgacgaggcgacgttcgactcgcggccggtgctctacccgatggggcgg
gtcggttccggcctgggccggggcgagcgggacacgctcctggccgtcctgcgcgacacg
gagcggccgacgcccccgttcgatcccgcgcccacggacccgatggcgcgccgggcgcgg
tgggtggagcccatgctgtgcgtgcaggtgcgctacctggaggtcacacccgacggggcg
ctgcggcagccggtgctgcgggcgctgcggccggatgtgtcgccggtcgacgcggccgcg
gcggccctgctgccgacggctccctga

DBGET integrated database retrieval system